From 3ed2226582b97bddc098e6514648bcd3fa5226d8 Mon Sep 17 00:00:00 2001
From: criscuol <alexis.criscuolo@pasteur.fr>
Date: Sat, 24 Oct 2020 18:09:08 +0200
Subject: [PATCH] 1.2b

---
 README.md       | 57 ++++++++++++++++++++++++++++------------------
 src/EFASTA.java | 60 ++++++++++++++++++++++++-------------------------
 src/Makefile    |  8 -------
 3 files changed, 65 insertions(+), 60 deletions(-)
 delete mode 100644 src/Makefile

diff --git a/README.md b/README.md
index 215b426..e796846 100644
--- a/README.md
+++ b/README.md
@@ -8,34 +8,47 @@ The source code of _eFASTA_ is inside the _src_ directory and could be compiled
 
 #### Building an executable jar file
 
-On computers with [Oracle JDK](http://www.oracle.com/technetwork/java/javase/downloads/index.html) (6 or higher) installed, a Java executable jar file could be created. In a command-line window, go to the _src_ directory and type:
+Clone this repository with the following command line:
+```bash
+git clone https://gitlab.pasteur.fr/GIPhy/eFASTA.git
+```
+On computers with [Oracle JDK](http://www.oracle.com/technetwork/java/javase/downloads/index.html) (6 or higher) installed, a Java executable jar file can be created. In a command-line window, go to the _src_ directory and type:
 ```bash
 javac EFASTA.java 
 echo Main-Class: EFASTA > MANIFEST.MF 
 jar -cmvf MANIFEST.MF EFASTA.jar EFASTA.class 
 rm MANIFEST.MF EFASTA.class 
 ```
-This will create the executable jar file `EFASTA.jar` that could be launched with the following command line model:
+This will create the executable jar file `EFASTA.jar` that could be run with the following command line model:
 ```bash
 java -jar EFASTA.jar [options]
 ```
 
 #### Building a native code binary
 
-On computers with the [GNU compiler GCJ](https://gcc.gnu.org/onlinedocs/gcc-4.2.4/gcj/) installed, a binary could also be built. In a command-line window, go to the _src_ directory, and type:
+Clone this repository with the following command line:
+```bash
+git clone https://gitlab.pasteur.fr/GIPhy/eFASTA.git
+```
+On computers with [GraalVM](https://www.graalvm.org/downloads/) installed, a native executable can be built. In a command-line window, go to the _src_ directory, and type:
 ```bash
-make
+javac EFASTA.java 
+native-image EFASTA eFASTA
+rm EFASTA.class
 ```
-This will create the executable binary file `eFASTA` that could be launched with the following command line model:
+This will create the native executable `eFASTA` that can be run with the following command line model:
 ```bash
 ./eFASTA [options]
 ```
 
+
 ## Usage
 
-Launch _eFASTA_ without option to read the following documentation:
+Run _eFASTA_ without option to read the following documentation:
 
 ```
+ eFASTA
+
  USAGE:   eFASTA <options>
 
   where options are:
@@ -52,17 +65,17 @@ Launch _eFASTA_ without option to read the following documentation:
                                    leading to  the  writing  of  its  amino  acid  translation
                                    (standard  genetic  code)  into  a  second  FASTA-formatted
                                    output file [basename].faa
-   -fcds                           to search for  the full CDS  (starting and  ending by start
-                                   and  stop codons,  respectively)  that includes  the region
+   -fcds                           to search for  the full CDS  (starting and  ending by START
+                                   and  STOP codons,  respectively)  that includes  the region
                                    specified by option -c
-   -orf                            to search for the ORF  (starting and ending by stop codons)
+   -orf                            to search for the ORF  (starting and ending by STOP codons)
                                    that includes the region specified by option -c
-   -start, -init <string>          (only with options -cds  and -fcds) several alternate start
+   -start, -init <string>          (only with options -cds  and -fcds) several alternate START
                                    codons (non ATG) could be specified with this option:
                                     PROK    = ATG GTG TTG
                                     PROK+   = ATG GTG TTG CTG ATT
                                     PROK++  = ATG GTG TTG CTG ATT ATC ATA
-   -stop                           (only with options -cds, fcds and -orf) to include the stop
+   -stop                           (only with options -cds, -fcds or -orf) to include the STOP
                                    codon in the outputed sequences
 ```
 
@@ -74,7 +87,7 @@ The directory _example_ contains the FASTA-formatted file _Ecoli.O104H4.plsm.fna
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293
 ```
-This command line allows writing the file _seq.fna_ containing the following nucleotide segment:
+This command line creates the file _seq.fna_ containing the following nucleotide segment:
 ```
 >CP003291.1 plasmid pAA-EA11::31400-31293
 GGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTG
@@ -84,7 +97,7 @@ GGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATG
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293  -orf
 ```
-This command line allows writing the file _seq.fna_ with the smallest ORF containing the specified region:
+This command line creates the file _seq.fna_ with the smallest ORF containing the specified region:
 ```
 >CP003291.1 plasmid pAA-EA11::31433-31266
 GTACAGGGCTGGAGCTTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTGCCATGGAACGTAGTACTCACCAATAAA
@@ -95,11 +108,11 @@ as well as  the file _seq.faa_ containing its translation (standard genetic code
 VQGWSLCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK
 ```
 
-##### Open Reading Frame (ORF) with codons stop
+##### Open Reading Frame (ORF) with codons STOP
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293  -orf  -stop
 ```
-This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the ORF and its translation, respectively, with the two ending-up stop codons:
+This command line creates the two files _seq.fna_ and _seq.faa_ containing the ORF and its translation, respectively, with the two ending-up codons STOP:
 ```
 >CP003291.1 plasmid pAA-EA11::31436-31263
 TGAGTACAGGGCTGGAGCTTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTGCCATGGAACGTAGTACTCACCAATAAATAA
@@ -113,23 +126,23 @@ TGAGTACAGGGCTGGAGCTTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGC
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293  -fcds
 ```
-This command line allows writing the file _seq.fna_ with the the smallest putative CDS containing the specified region:
+This command line creates the file _seq.fna_ with the the smallest putative CDS containing the specified region:
 ```
 >CP003291.1 plasmid pAA-EA11::31433-31266
 GTACAGGGCTGGAGCTTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTGCCATGGAACGTAGTACTCACCAATAAA
 ```
-as well as  the file _seq.faa_ containing its translation (standard genetic code):
+as well as the file _seq.faa_ containing its translation (standard genetic code):
 ```
 >CP003291.1 plasmid pAA-EA11::31433-31266
 VQGWSLCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK
 ```
-Of note, it is the same results as with option `-orf` because the stop codon TGA is occuring first (before any start codon ATG).
+Of note, it is the same results as with option `-orf` because the STOP codon TGA is occurring first (before any START codon ATG).
 
-##### Coding Sequence (CDS) with alternate codon start
+##### Coding Sequence (CDS) with alternate codon START
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293  -fcds  -start PROK
 ```
-This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the CDS and its translation, respectively, by considering each of the three codons ATG, GTG and TTG as a putative start codon:
+This command line creates the two files _seq.fna_ and _seq.faa_ containing the CDS and its translation, respectively, by considering each of the three codons ATG, GTG and TTG as a putative codon START:
 ```
 >CP003291.1 plasmid pAA-EA11::31418-31266
 TTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTGCCATGGAACGTAGTACTCACCAATAAA
@@ -139,11 +152,11 @@ TTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCT
 MCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK
 ```
 
-##### Coding Sequence (CDS) with alternate start codon and stop codon
+##### Coding Sequence (CDS) with alternate codons START and codon STOP
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293  -fcds  -start PROK  -stop
 ```
-This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the CDS and its translation, respectively, by considering each of the three codons ATG, GTG and TTG as a putative start codon, and including the termination codon:
+This command line creates the two files _seq.fna_ and _seq.faa_ containing the CDS and its translation, respectively, by considering each of the three codons ATG, GTG and TTG as a putative codon START, and including the termination codon:
 ```
 >CP003291.1 plasmid pAA-EA11::31418-31263
 TTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTGCCATGGAACGTAGTACTCACCAATAAATAA
diff --git a/src/EFASTA.java b/src/EFASTA.java
index 4077964..cf9ddcb 100644
--- a/src/EFASTA.java
+++ b/src/EFASTA.java
@@ -1,30 +1,30 @@
 /*
-  ####################################################################
-  EFASTA: extracting nucleotide segments from FASTA file
-
-  Copyright (C) 2017,2018  Alexis Criscuolo 
+  ########################################################################################################
 
-  This program is free software: you can redistribute it and/or modify
-  it under the terms of the GNU General Public License as published by
-  the Free Software Foundation,  either version 3  of the License,  or
+  EFASTA: extracting nucleotide segments from FASTA file
+  
+  Copyright (C) 2017-2020  Institut Pasteur
+  
+  This program  is free software:  you can  redistribute it  and/or modify it  under the terms  of the GNU
+  General Public License as published by the Free Software Foundation, either version 3 of the License, or
   (at your option) any later version.
   
-  This program is distributed in the hope that it will be useful,  but
-  WITHOUT  ANY  WARRANTY;   without  even  the   implied  warranty  of
-  MERCHANTABILITY or  FITNESS FOR  A PARTICULAR  PURPOSE.  See the GNU 
-  General Public License for more details.
+  This program is distributed in the hope that it will be useful,  but WITHOUT ANY WARRANTY;  without even
+  the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU General Public
+  License for more details.
   
-  You should have  received a copy  of the GNU  General Public License
-  along with this program. If not, see <http://www.gnu.org/licenses/>.
-
-  Contact: 
-  Institut Pasteur
-  Bioinformatics and Biostatistics Hub
-  C3BI, USR 3756 IP CNRS
-  Paris, FRANCE
+  You should have received a copy of the  GNU General Public License along with this program.  If not, see
+  <http://www.gnu.org/licenses/>.
+  
+  Contact:
+   Alexis Criscuolo                                                            alexis.criscuolo@pasteur.fr
+   Genome Informatics & Phylogenetics (GIPhy)                                             giphy.pasteur.fr
+   Bioinformatics and Biostatistics Hub                                 research.pasteur.fr/team/hub-giphy
+   USR 3756 IP CNRS                          research.pasteur.fr/team/bioinformatics-and-biostatistics-hub
+   Dpt. Biologie Computationnelle                     research.pasteur.fr/department/computational-biology
+   Institut Pasteur, Paris, FRANCE                                                     research.pasteur.fr
 
-  alexis.criscuolo@pasteur.fr
-  ####################################################################
+  ########################################################################################################
 */
 
 import java.io.*;
@@ -32,7 +32,7 @@ import java.util.*;
 
 public class EFASTA {
     //### constants ##########
-    final static String VERSION = "1.2.180511ac";
+    final static String VERSION = "1.2b.201024ac";
     final static String[] CODON =   {"AAA" , "AAC" , "AAG" , "AAT" ,  // A A -
 				     "ACA" , "ACC" , "ACG" , "ACT" ,  // . C -
 				     "AGA" , "AGC" , "AGG" , "AGT" ,  // . G -
@@ -97,9 +97,9 @@ public class EFASTA {
 	// ###########################
 	if ( args.length < 2 ) {
 	    System.out.println("");
-	    System.out.println(" eFASTA v." + VERSION);
+	    System.out.println(" eFASTA v." + VERSION + "                              Copyright (C) 2017-2020  Institut Pasteur");
 	    System.out.println("");
-	    System.out.println(" USAGE:   eFASTA <options>");
+	    System.out.println(" USAGE:   eFASTA  [options]");
 	    System.out.println("");
 	    System.out.println("  where options are:");
 	    System.out.println("");
@@ -115,20 +115,20 @@ public class EFASTA {
 	    System.out.println("                                   leading to  the  writing  of  its  amino  acid  translation");
 	    System.out.println("                                   (standard  genetic  code)  into  a  second  FASTA-formatted");
 	    System.out.println("                                   output file [basename].faa");
-	    System.out.println("   -fcds                           to search for  the full CDS  (starting and  ending by start");
-	    System.out.println("                                   and  stop codons,  respectively)  that includes  the region");
+	    System.out.println("   -fcds                           to search for  the full CDS  (starting and  ending by START");
+	    System.out.println("                                   and  STOP codons,  respectively)  that includes  the region");
 	    System.out.println("                                   specified by option -c");
-	    System.out.println("   -orf                            to search for the ORF  (starting and ending by stop codons)");
+	    System.out.println("   -orf                            to search for the ORF  (starting and ending by STOP codons)");
 	    System.out.println("                                   that includes the region specified by option -c");
-	    System.out.println("   -start, -init <string>          (only with options -cds  and -fcds) several alternate start");
+	    System.out.println("   -start, -init <string>          (only with options -cds  and -fcds) several alternate START");
 	    System.out.println("                                   codons (non ATG) could be specified with this option:");
 	    System.out.println("                                    PROK    = ATG GTG TTG");
 	    System.out.println("                                    PROK+   = ATG GTG TTG CTG ATT");
 	    System.out.println("                                    PROK++  = ATG GTG TTG CTG ATT ATC ATA");
-	    System.out.println("   -stop                           (only with options -cds, fcds and -orf) to include the stop");
+	    System.out.println("   -stop                           (only with options -cds, -fcds or -orf) to include the STOP");
 	    System.out.println("                                   codon in the outputed sequences");
 	    System.out.println("");
-	    System.exit(1);
+	    System.exit(0);
 	}
 	
 	// ###########################
diff --git a/src/Makefile b/src/Makefile
deleted file mode 100644
index 861a98c..0000000
--- a/src/Makefile
+++ /dev/null
@@ -1,8 +0,0 @@
-GCJ=gcj
-GCJFLAGS=-fsource=1.6 -march=native -msse2 -O3 -minline-all-stringops -fomit-frame-pointer -momit-leaf-frame-pointer -fstrict-aliasing -fno-store-check -fno-bounds-check -funroll-all-loops -Wall 
-OTHERFLAGS=-funsafe-math-optimizations -ffast-math
-MAIN=EFASTA
-EXEC=eFASTA
-
-eFASTA: EFASTA.java
-	$(GCJ) $(GCJFLAGS) --main=$(MAIN) $(MAIN).java -o $(EXEC)
-- 
GitLab