From 7598e97f29ce9a7312290e8ee5a1f979088ac453 Mon Sep 17 00:00:00 2001 From: Alexis CRISCUOLO <alexis.criscuolo@pasteur.fr> Date: Tue, 15 May 2018 08:00:23 +0200 Subject: [PATCH] Update README.md --- README.md | 1 + 1 file changed, 1 insertion(+) diff --git a/README.md b/README.md index fd1ca6b..97cbf4f 100644 --- a/README.md +++ b/README.md @@ -123,6 +123,7 @@ as well as the file _seq.faa_ containing its translation (standard genetic code >CP003291.1 plasmid pAA-EA11::31433-31266 VQGWSLCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK ``` +Of note, it is the same results as with option `-orf` because the stop codon TGA is occuring first (before any start codon ATG). ##### Coding Sequence (CDS) with alternate codon start ```bash -- GitLab