Commit 0635f8ed authored by Amandine  PERRIN's avatar Amandine PERRIN
Browse files

Welcome to Panna cotta recipe

parents
Pipeline #77876 passed with stages
in 7 minutes and 4 seconds
[DEFAULT]
#threads = 1
#quiet = False
#verbose = 0
[prepare]
#ncbi_taxid =
#ncbi_species_taxid =
#ncbi_species_name =
#ncbi_section = refseq
#levels = all
#strains =
#tmp_dir =
#db_dir =
#info_file =
#l90 = 100
#nbcont = 999
#cutn = 5
#min_dist = 1e-4
#max_dist = 0.06
#norefseq = False
#only_mash = False
[annotate]
#list_file =
#qc_only = False
#db_path =
#prodigal_only = False
#small = False
#name =
#date =
#l90 = 100
#nbcont = 999
#cutn = 5
#from_info = false
[pangenome]
#min_id = 0.8
#clust_mode = 1
#outfile =
#spedir =
[align]
#prot_ali = False
[corepers]
#tol = 1
#multi = False
#mixed = False
#floor = False
[tree]
#soft = fasttree
#model =
#boot = 0
#write_boot = False
#memory =
fast = True
\ No newline at end of file
1 GEN4.1111.00001.0001b_00001 GENO.0321.00001.0001b_00002 GENO.1216.00002.0001b_00001 GENO.1216.00002.0001i_00002
2 GEN4.1111.00001.0001i_00003
3 GEN4.1111.00001.0001i_00005 GENO.0321.00001.0002i_00005 GENO.1216.00002.0001i_00006
4 GEN4.1111.00001.0001i_00008 GENO.0321.00001.0002i_00010 GENO.1216.00002.0002b_00009
5 GEN4.1111.00001.0001b_00009 GENO.0321.00001.0002b_00011 GENO.1216.00002.0002b_00010
6 GENO.0321.00001.0001b_00001
7 GEN4.1111.00001.0001i_00002 GENO.0321.00001.0002b_00003 GENO.1216.00002.0001i_00003
8 GENO.0321.00001.0002i_00008
9 GEN4.1111.00001.0001i_00007 GENO.0321.00001.0002i_00009 GENO.1216.00002.0001b_00008
10 GENO.1216.00002.0001i_00004
11 GEN4.1111.00001.0001i_00004 GENO.0321.00001.0002i_00004 GENO.1216.00002.0001i_00005
12 GEN4.1111.00001.0001i_00006 GENO.0321.00001.0002i_00006 GENO.0321.00001.0002i_00007 GENO.1216.00002.0001i_00007
13 GENO.1216.00002.0003b_00011
14 GENO.1216.00002.0003b_00012
genome1.fst
genome2.fst :: GEN2
genome3-chromo.fst genome3-plasmid.fst :: .1216
genome4.fst :: GEN4.1111
\ No newline at end of file
>GEN4.1111.00001.0001b_00001 831 amiD | N-acetylmuramoyl-L-alanine amidase AmiD | 3.5.1.28 | similar to AA sequence:UniProtKB:P75820 | COG:COG3023
ATGAAAGCGCTACTGTGGCTGGTGGGTCTCGCGTTGCTGTTAACAGGCTGCGCGAGCGAA
AAAGGAATTATCGATAAAGAGGGATATCAGCTTGATACCCGACATCGGGCGCAGGCGGCC
TATCCGCGCATTAAAGTCCTGGTGATTCACTATACGGCGGAAAACTTTGACGTTTCGCTG
GCGACGTTAACGGGCCGCAACGTCAGTTCGCATTACCTGATTCCCGCAACCCCGCCATTA
TATGGCGGTAAACCGCGCATCTGGCAACTGGTGCCGGAACAGGATCAGGCCTGGCATGCG
GGCGTCAGTTTCTGGCGAGGCGCCACGCGTCTCAATGATACGTCTATTGGCATTGAGCTG
GAAAATCGCGGCTGGCGAATGTCCGGCGGGGTGAAATCTTTCGCGCCGTTTGAATCCGCG
CAAATTCAGGCATTGATTCCGTTAGCGAAGGACATTATCGCGCGCTATGACATCAAACCG
CAGAATGTGGTGGCCCATGCGGATATCGCGCCGCAGCGTAAAGACGATCCCGGCCCGCGC
TTCCCGTGGCGCGAGCTGGCGGCGCAGGGGATTGGCGCCTGGCCTGACGCCCAGCGTGTG
GCGTTTTATCTGGCTGGACGCGCGCCGTATACGCCAGTCGATACCGCAACGGTGCTTGCG
TTACTCTCGCGCTATGGCTATGAAGTCAAAGCCGATATGACGGCGCGCGAGCAGCAGCGG
GTGATTATGGCGTTCCAGATGCACTTCCGTCCGGCGCAATGGAACGGTATCGCAGATGCC
GAAACGCAGGCGATTGCCGAAGCATTACTGGAGAAGTACGGCCAGGATTAA
>GEN4.1111.00001.0001i_00002 381 hpcD | 5-carboxymethyl-2-hydroxymuconate Delta-isomerase | 5.3.3.10 | similar to AA sequence:UniProtKB:Q05354 | NA
ATGCCGCACTTTATTGCTGAATGTACTGAAAATATTCGCGAGCAGGCTGATTTACCCGGC
CTGTTCAGCAAGGTAAACGAGGCGCTGGCCGCCAGCGGGATTTTCCCCATCGGCGGTATC
CGCAGTCGCGCCCACTGGCTGGATACCTGGCAGATGGCTGACGGTAAGCATGATTATGCG
TTTGTGCATATGACGCTGAAAATCGGTACCGGGCGCAGCCTGGAGAGCCGTCAGGAAGTC
GGCGAAATGCTGTTTGGGCTGATTAAAGCCCACTTCGCCGACCTGATGGAGAACCGCTAT
CTGGCGCTGTCGTTTGAGATTGCCGAGCTACATCCGACGCTCAATTACAAACAAAACAAC
GTACACGCGTTATTTAAATAG
>GEN4.1111.00001.0001i_00003 804 hpcG | 2-oxo-hept-4-ene-1,7-dioate hydratase | 4.2.1.163 | similar to AA sequence:UniProtKB:P42270 | NA
ATGCTCGATAAACAGACCCATACCCTGATCGCCCAGCGACTTAATCAGGCTGAAAAACAG
CGTGAACAAATTCGCGCAGTGTCGCTGGATTATCCCAACATCACTATTGAAGATGCCTAT
GCCGTACAGCGTGAATGGGTCAATATCAAGATCGCCGAAGGGCGCACGCTCAAAGGCCAC
AAAATCGGCCTGACCTCAAAAGCGATGCAGGCCAGCTCGCAAATCAGCGAACCGGATTAC
GGCGCGCTGCTTGACGATATGTTCTTCCATGACGGCGGCGATATCCCCACCGACCGTTTT
ATCGTCCCGCGTATTGAAGTGGAGCTGGCGTTCGTGCTGGCGAAACCGCTGCGCGGCCCT
CACTGCACGCTGTTCGACGTCTACAACGCCACGGATTATGTGATTCCGGCGCTGGAACTG
ATTGACGCCCGCAGCCACAACATCGACCCGGAAACCCAGCGCCCGCGCAAAGTGTTCGAC
ACCATTTCCGACAACGCCGCCAACGCCGGGGTGATCCTCGGTGGTCGCCCCATCAAACCA
GACGAGCTGGATCTGCGCTGGATCTCCGCGCTGCTCTATCGCAACGGCGTGATCGAAGAA
ACCGGCGTCGCCGCAGGCGTGCTGAATCATCCGGCCAACGGCGTGGCGTGGCTGGCGAAC
AAGCTTGCCCCCTACGATGTCCAGCTTGAAGCCGGGCAGATCATCCTCGGCGGCTCGTTC
ACCCGCCCGGTGCCGGCGAGCAAGGGCGACACCTTCCATGTCGATTACGGCAACATGGGC
GCGATCAGTTGCCGGTTTGTGTAA
>GEN4.1111.00001.0001i_00004 1404 NA | hypothetical protein | NA | NA | NA
ATGCCCGTGAATAAGTTCTCCCGACGTACCCTCCTGACGGCAGGTTCCGCGCTTGCTGTT
CTTCCTTTTCTGCGCGCCTTGCCGGTACAGGCGCGTGAACCTCGCGAGACCGTCGATATT
AAGGATTATCCGGCGGATGACGGTATCGCCTCGTTCAAACAGGCCTTCGCCGACGGACAG
ACCGTGGTCTTACCGCCAGGATGGGTGTGTGAAAATATCAATGCGGCGATAACGATTCCG
GCGGGAAAAACGCTGCGGGTACAGGGCGCGGTGCGTGGGAATGGCCGGGGACGGTTTATT
TTGCAGGACGGGTGTCAGGTGGTGGGGGAGCAGGGCGGCAGTCTGCACAATGTGACGCTG
GATGTTCGCGGGTCGGACTGTGTGATTAAAGGCGTGACGATGAGCGGCTTTGGCCCCGTC
GCGCAAATTTTCATCGGCGGTAAGGAACCGCAGGTGATGCGTAATCTCATTATCGATGAC
ATCACCGTTACCCACGCCAACTACGCCATTCTCCGCCAGGGATTTCATAACCAAATGGAC
GGCGCGCGGATTACGCATAGCCGCTTTAGCGATTTGCAGGGGGACGCCATTGAGTGGAAT
GTCGCGATTCACGACCGCGACATCCTGATTTCCGATCATGTCATCGAACGCATTGATTGT
ACCAATGGCAAAATCAACTGGGGGATCGGCATCGGGCTGGCGGGTAGCACCTATGACAAC
AGTTATCCTGAAGATCAGGCAGTAAAAAACTTTGTGGTGGCCAATATTACCGGATCTGAT
TGCCGACAGCTGGTGCACGTAGAAAATGGCAAACATTTCGTCATTCGCAATGTCAAAGCC
AAAAACATCACGCCCGATTTCAGTAAAAATGCGGGTATTGATAACGCAACGATCGCCATT
TATGGCTGTGATAATTTCGTCATTGATAATATTGATATGACGAATAGTGCTGGGATGCTC
ATCGGCTATGGCGTCGTTAAAGGAAAATACCTGTCAATTCCGCAAAACTTTAAATTAAAC
GCTATTCGGTTGGATAATCGCCAGGTTGCTTATAAATTACGCGGCATTCAAATTTCCTCC
GGCAACATCCCCTCTTTTGTCGCCATCACCAATGTACGGATGACGCGTGCTACGCTGGAA
CTGCATAATCAACCGCAGCACCTCTTTCTGCGTAATATCAACGTGATGCAAACTTCAGCG
ATTGGCCCGGCGTTAAAAATGCATTTCGATTTGCGTAAAGATGTCCGTGGTCAATTTATG
GCCCGCCAGGACACGCTGCTTTCCCTCGCTAATGTTCATGCCATCAATGAAAACGGGCAG
AGTTCCGTGGATATCGACAGGATTAATCACCAAACCGTGAATGTCGAAGCAGTGAATTTT
TCGCTGCCGAAGCGGGGAGGGTAA
>GEN4.1111.00001.0001i_00005 774 hisP | Histidine transport ATP-binding protein HisP | NA | similar to AA sequence:UniProtKB:P02915 | COG:COG4598
ATGTCAGAAAATAAATTACACGTTATCGATTTGCACAAACGCTACGGCGGTCATGAAGTG
CTGAAAGGGGTATCGTTGCAGGCCCGCGCCGGAGATGTGATTAGCATCATCGGCTCGTCC
GGCTCCGGTAAAAGCACTTTTTTGCGCTGTATTAACTTCCTCGAAAAACCGAGCGAAGGC
GCGATTATCGTGAACGGTCAGAACATTAATCTGGTGCGCGACAAAGACGGGCAGCTCAAA
GTGGCGGATAAAAATCAGCTACGCTTGTTGCGTACCCGCCTGACGATGGTGTTTCAGCAC
TTTAACCTCTGGAGCCACATGACGGTGCTGGAAAATGTGATGGAAGCGCCGATTCAGGTA
CTGGGATTAAGCAAGCACGACGCGCGCGAGCGGGCGTTGAAATATCTGGCGAAGGTGGGG
ATTGATGAGCGCGCTCAGGGCAAATATCCCGTCCATCTCTCCGGCGGCCAACAGCAGCGC
GTTTCTATTGCGCGCGCGCTGGCGATGGAACCTGACGTTTTACTGTTCGATGAACCCACA
TCGGCGCTCGATCCTGAACTGGTCGGCGAAGTGTTGCGCATCATGCAACAACTGGCGGAA
GAAGGCAAAACGATGGTGGTGGTCACGCATGAAATGGGCTTCGCCCGCCATGTCTCTTCG
CACGTTATTTTTCTGCATCAGGGGAAAATTGAAGAAGAGGGCGATCCGGAGCAGGTGTTC
GGCAATCCGCAAAGCCCGCGTTTACAGCAATTCCTGAAAGGCTCGCTGAAATAA
>GEN4.1111.00001.0001i_00006 768 trmD | tRNA (guanine-N(1)-)-methyltransferase | 2.1.1.228 | similar to AA sequence:UniProtKB:P0A873 | COG:COG0336
GTGTTTATTGGCATCGTTAGCCTGTTTCCTGAAATGTTCCGCGCAATTACCGATTACGGG
GTAACTGGCCGGGCAGTAAAAAAAGGCCTGCTGAACATCCAAAGCTGGAGTCCTCGCGAC
TTCGCGCATGACCGGCACCGTACCGTGGACGACCGTCCTTACGGCGGCGGACCGGGGATG
TTAATGATGGTGCAACCCTTGCGGGACGCCATTCACGCAGCAAAAGCCGCGGCAGGTGAA
GGCGCTAAAGTGATTTATCTGTCGCCTCAGGGACGCAAGCTTGATCAAGCGGGCGTTAGC
GAGCTGGCCACGAATCAGAAGCTTATTCTGGTGTGTGGTCGCTACGAAGGCGTAGATGAG
CGCGTAATTCAGACCGAAATTGACGAAGAATGGTCAATTGGCGATTACGTTCTCAGCGGT
GGCGAACTACCGGCAATGACGCTGATTGACTCCGTCGCCCGGTTTATACCGGGGGTTCTG
GGGCATGAGGCATCAGCAATCGAAGATTCGTTTGCTGATGGGTTGCTGGATTGTCCGCAC
TATACGCGCCCTGAAGTGTTAGAGGGGATGGAAGTACCGCCAGTATTGCTGTCGGGAAAC
CATGCCGAGATACGTCGCTGGCGCTTGAAACAGTCGCTGGGCCGAACCTGGCTTAGAAGA
CCTGAACTTCTGGAAAACCTGGCTCTGACTGAAGAGCAAGCAAGGTTGCTGGCGGAGTTC
AAAACAGAACACGCACAACAGCAGCATAAACATGATGGGATGGCATAG
>GEN4.1111.00001.0001i_00007 261 NA | hypothetical protein | NA | NA | NA
ATGGCTGGGTTGCACGCGCCATATGCATATAGCGCGCATCATGCGGTGAATTTCTGTTCT
GAGTATAAACGTGGCTTTGTATTGGGTTTTACACACCGTATGTTCGAAAAGACCGGCGAT
CGTCAACTTAGCGCGTGGGAGGCCGGAATTCTGACGCGTCGCTATGGTCTGGATAAAGAA
ATGGTGATGGATTTCTTTAAAGAGAATCATTCCGGGATGGCGGTTCGCTTCTTTATGGTC
GGTTATCGACTCGAAGGTTGA
>GEN4.1111.00001.0001i_00008 582 NA | hypothetical protein | NA | NA | NA
ATGTCTACGCTTCTCTATTTGCACGGATTCAACAGTTCCCCTCGCTCGGCAAAAGCGTGC
CAGCTAAAAAACTGGCTGGCGGAGCGTCATCCGCATGTCGAGATGATCGTCCCTCAACTA
CCGCCGTATCCTGCCGATGCGGCGGAGTTGCTGGAATCTCTCGTGCTTGAGCATGGCGGT
GCGCCATTAGGGCTGGTAGGATCGTCGCTGGGTGGTTATTACGCCACCTGGCTGTCGCAA
TGTTTTATGCTGCCGGCTGTGGTGGTGAATCCCGCCGTGCGGCCCTTTGAATTACTGACC
GACTATCTCGGTCAGAACGAGAACCCCTACACCGGGCAGCAATATGTGCTAGAGTCTCGC
CATATTTATGATCTTAAAGTCATGCAGATTGACCCGCTGGAAGCGCCGGACCTGATCTGG
CTACTGCAACAGACGGGCGATGAAGTGCTGGATTACCGCCAGGCGGTGGCATATTACGCC
TCCTGCCGTCAGACAGTGACCGAGGGTGGTAATCACGCATTCACGGGCTTCGAAGATTAT
TTCAACCAGATTGTCGATTTTCTTGGACTGCACAGTTGCTGA
>GEN4.1111.00001.0001b_00009 1083 dctM | C4-dicarboxylate TRAP transporter large permease protein DctM | NA | similar to AA sequence:UniProtKB:O07838 | COG:COG1593
ATGAATAGCGGGGGAATTGCCGCCCGGCTGGTCAATTTTGCCAAACTGTTTACTGGCAAA
CTGCCCGGCTCGCTCTCTTATACCAACATCGTCGGCAATATGATGTTCGGTGCAATTTCC
GGATCGGCAATTGCCGCCTCAACCTCCATCGGCGGCGTGATGGTGCCGATGAGCGCGCGC
GAAGGTTACGATCGCGGCTTTGCGGCCGCGGTGAATATCGCCTCCGCGCCGACGGGAATG
TTAATTCCGCCCACCACGGCTTTTATCCTTTATGCGCTGGCAAGCGGGGGAACATCGATT
GCCGCTCTGTTCGCCGGCGGTCTGGTCGCGGGAGTGCTGTGGGGCGTTGGCTGTATGCTG
GTCACGCTGGTGGTCGCTAAGCGTCGAAATTATCGGGTTTTCTTCACCGTCCAAAAAGGC
ATGGCGCTAAAAGTTGCCGTTGAGGCCATTCCCAGCCTGCTGCTGATCGTGATTATCGTC
GGCGGCATTGTGCAGGGGATTTTCACCGCCATTGAAGCCTCCGCGATTGCCGTGGTGTAT
ACATTATTGTTGACGATGGTGTTTTACCGCACGCTGAAAATTAAGGATTTGCCTTCGATT
TTGCTCCAGACAGTGGTAATGACCGGGGTCATCATGTTCCTGCTGGCAACCTCTTCGGCG
ATGTCCTTCTCGATGTCGATCACCAATATTCCTGCGGCGCTGAGCGATATGATCCTCGGT
ATTTCCGCCAATAAACTGGTTATCCTGTTAGTCATTACCGTCTTTTTGTTGATTATCGGC
GCATTTATGGATATCGGTCCGGCCATTCTGATTTTTACCCCGATTCTGCTGCCGATCATG
GCTAAACTGGGCGTCGATCCGGTGCATTTTGGCATTATCATGATCTATAACCTGGCGATT
GGCACCATTACGCCGCCAGTTGGCAGTGGTTTATATGTCGGGGCGAGCGTCGGTAAGGTC
AAAGTTGAGGAAGTGATTAAACCGTTGCTGCCTTTTTACGGCGCGATTATCGGCGTTCTG
TTATTAATTACCTACATTCCGGAAATCACACTGTTCTTACCCCGTCTACTGGGCATCATG
TAA
>GENO.0321.00001.0001b_00001 1668 glnS | Glutamine--tRNA ligase | 6.1.1.18 | similar to AA sequence:UniProtKB:P00962 | COG:COG0008
ATGAGTGAGGCTGAAGCCCGCCCGACTAACTTTATTCGTCAGATTATTGATGAAGATCTG
GCGAGTGGTAAACATACCACTGTCCATACCCGTTTTCCGCCGGAGCCGAATGGCTATCTG
CATATCGGCCACGCGAAATCTATCTGCCTGAACTTTGGCATCGCGCAAGATTATCAGGGC
CAGTGCAACCTGCGTTTCGATGACACCAACCCGGTAAAAGAAGATATCGAGTACGTTGAT
TCGATCAAAAACGACGTCGAGTGGTTAGGCTTTCACTGGTCTGGCGATATTCGCTACTCC
TCCGATTACTTTGACCAACTGCACGCCTATGCGGTCGAGCTAATCAATAAAGGCCTGGCC
TATGTTGATGAGCTGACGCCGGAGCAGATCCGTGAATACCGCGGTACGCTGACCGCGCCG
GGTAAAAACAGCCCGTTCCGCGATCGCAGCGTCGAAGAGAACCTCGCGCTATTTGAAAAA
ATGCGTACCGGCGGTTTTGAAGAGGGTAAAGCCTGTCTGCGCGCTAAAATCGACATGGCG
TCGCCGTTTATCGTGATGCGCGATCCGGTGCTGTATCGCATTAAATTCGCCGAGCATCAT
CAGACTGGCAACAAGTGGTGCATCTATCCGATGTACGACTTTACTCACTGCATCAGCGAT
GCGCTGGAAGGCATTACTCATTCTCTGTGTACGCTGGAGTTCCAGGATAACCGTCGTCTG
TACGACTGGGTGCTGGACAACATCACCATTCCGGTTCACCCGCGCCAGTACGAATTCTCG
CGCCTGAATCTGGAATACACCGTGATGTCCAAGCGTAAGCTGAACCTGCTGGTGACCGAC
AAACACGTCGAAGGTTGGGACGATCCGCGTATGCCGACTATTTCCGGTCTGCGCCGTCGC
GGCTATACCGCGGCTTCTATTCGTGAGTTCTGCAAACGCATCGGCGTCACCAAGCAGGAC
AACACTATTGAGATGGCGTCGCTGGAATCCTGCATTCGCGAAGATCTGAACGAAAACGCG
CCGCGCGCGATGGCGGTAATCGATCCGGTAAAACTGGTTATCGAAAATTACCCGCAGGGT
GAGAGCGAAATGGTTACCATGCCTAACCATCCGAATAAACCGGAGATGGGCAGCCGTGAA
GTGCCGTTTAGCGGTGAGATCTGGATCGATCGCGCAGATTTCCGCGAAGAAGCGAACAAA
CAGTACAAACGTCTGGTGATGGGCAAAGAAGTGCGTCTGCGTAATGCCTACGTCATTAAA
GCGGAGCGCGTAGAGAAGGATGCCGAAGGGAATATCACCACCATCTTCTGTACCTATGAT
GCTGATACGCTGAGTAAAGATCCGGCTGACGGGCGTAAAGTGAAAGGCGTAATCCACTGG
GTTAGCGCAGCACATGCGCTGCCGATTGAAATTCGTCTCTACGACCGTCTGTTCAGCGTG
CCGAATCCGGGCGCCGCGGAGGACTTCCTGTCTGTTATCAACCCCGAATCATTAGTGATT
AAGCAGGGGTATGGCGAGCCGTCGCTGAAAGCGGCGGTAGCAGGAAAAGCTTTCCAGTTT
GAACGTGAAGGCTACTTCTGCCTCGACAGCCGCTATGCAACGGCCGATAAGCTGGTCTTT
AACCGCACCGTGGGCCTGCGTGATACCTGGGCGAAAGCGGGCGAGTAA
>GENO.0321.00001.0001b_00002 831 amiD | N-acetylmuramoyl-L-alanine amidase AmiD | 3.5.1.28 | similar to AA sequence:UniProtKB:P75820 | COG:COG3023
ATGAAAGCGCTACTGTGGCTGGTGGGTCTCGCGTTGCTGTTAACAGGCTGCGCGAGCGAA
AAAGGAATTATCGATAAAGAGGGATATCAGCTTGATACCCGACATCGGGCGCAGGCGGCC
TATCCGCGCATTAAAGTCCTGGTGATTCACTATACGGCGGAAAACTTTGACGTTTCGCTG
GCGACGTTAACGGGTCGCAACGTCAGTTCGCATTACCTGATTCCCGCAACCCCGCCATTA
TATGGCGGTAAACCGCGCATCTGGCAACTGGTGCCGGAACAGGATCAGGCCTGGCATGCG
GGCGTCAGTTTCTGGCGAGGCGCCACGCGTCTCAATGATACGTCTATTGGCATTGAGCTG
GAAAATCGTGGTTGGCGAATGTCCGGCGGGGTGAAATCTTTCGCGCCGTTTGAATCCGCG
CAAATTCAGGCATTGATTCCGTTAGCGAAGGATATTATCGCGCGCTATAACATCAAACCG
CAGAATGTGGTGGCCCATGCGGATATCGCGCCGCAGCGTAAAGACGATCCCGGCCCGCGC
TTCCCGTGGCGCGAGCTGGCGGCGCAGGGGATTAGCGCCTGGCCTGACGCCCAGCGTGTG
GCGTTTTATCTGGCTGGACGCGCGCCGTATACGCCAGTCGATACCGCAACGGTGCTTGCG
TTACTCTCGCGCTATGGCTATGAAGTCAAAGCCGATATGACGGCACGCGAGCAGCAGCGG
GTGATTATGGCGTTCCAGATGCACTTCCGTCCGGCGCAATGGAACGGTATCGCAGATGCC
GAAACGCAGGCGATTGCCGAAGCATTACTGGAGAAGTACGGCCAGGATTAA
>GENO.0321.00001.0002b_00003 381 hpcD | 5-carboxymethyl-2-hydroxymuconate Delta-isomerase | 5.3.3.10 | similar to AA sequence:UniProtKB:Q05354 | NA
ATGCCGCACTTTATTGCTGAATGTACTGAAAATATTCGCGAGCAGGCTGATTTACCCGGC
CTGTTCAGCAAGGTAAACGAGGCGCTGGCCGCCAGCGGGATTTTCCCCATCGGCGGTATC
CGCAGTCGCGCCCACTGGCTGGATACCTGGCAGATGGCTGACGGTAAGCATGATTACGCG
TTTGTGCATATGACGCTGAAAATCGGCGCCGGGCGCAGCCTGGAGAGCCGTCAGGAAGTT
GGCGAAATGCTGTTTGGGCTGATTAAAGCCCACTTCGCCGACCTGATGGAGAACCGCTAT
CTGGCGCTGTCGTTTGAGATTGCCGAGCTACATCCGACGCTCAATTACAAACAAAACAAC
GTACACGCGTTATTTAAATAG
>GENO.0321.00001.0002i_00004 1410 NA | hypothetical protein | NA | NA | NA
ATGAGCATGCCCGCGACTAAATTCTCCCGACGTACCCTCCTGACGGCAGGTTCTGCGCTT
GCTGTTCTTCCTTTTCTGCGCGCCTTGCCGGTACAGGCGCGTGAACCTCGCGAGACCGTC
GATATTAAGGATTATCCGGCGGATGACGGTATCGCCTCGTTCAAACAGGCCTTCGCCGAC
GGACAGACCGTGGTCGTACCGCCAGGATGGGTGTGTGAAAATATCAATGCGGCGATAACG
ATTCCGGCGGGAAAAACGCTGCGGGTACAGGGCGCGGTGCGTGGGAATGGCCGGGGACGG
TTTATTTTGCAGGACGGGTGTCAGGTGGTGGGGGAGCAGGGCGGCAGTCTGCACAATGTG
ACGCTGGATGTTCGCGGGTCGGACTGTGTGATTAAAGGCGTGGCGATGAGCGGCTTTGGC
CCCGTCGCGCAAATTTTCATCGGTGGTAAGGAACCGCAGGTGATGCGTAATCTCATTATC
GATGACATCACCGTTACCCACGCCAACTACGCCATTCTCCGCCAGGGATTTCATAACCAA
ATGGATGGCGCGCGGATTACGCATAGCCGCTTTAGCGATTTACAGGGGGACGCCATTGAG
TGGAATGTCGCGATTCACGACCGCGACATCCTGATTTCCGATCATGTCATCGAACGCATT
AATTGTACCAATGGCAAAATCAACTGGGGGATCGGCATCGGGCTGGCGGGTAGCACCTAT
GACAACAGTTATCCTGAAGACCAGGCAGTAAAAAACTTTGTGGTGGCCAATATTACCGGA
TCTGATTGCCGACAGCTTGTGCACGTAGAAAATGGCAAACATTTCGTCATTCGCAATGTC
AAAGCCAAAAACATCACGCCCGGTTTCAGTAAAAATGCGGGTATTGATAACGCAACGATC
GCAATTTATGGCTGTGATAATTTCGTCATTGATAATATTGATATGACGAATAGTGCCGGG
ATGCTCATCGGCTATGGCGTCGTTAAAGGAAAATACCTGTCAATTCCGCAAAACTTTAAA
TTAAACGCTATTCGGTTGGATAATCGCCAGGTTGCTTATAAATTACGCGGCATTCAAATT
TCCTCCGGCAACACCCCCTCTTTTGTCGCCATCACCAATGTACGGATGACGCGTGCTACG
CTGGAACTGCATAATCAACCGCAGCACCTCTTTCTGCGCAATATCAACGTGATGCAAACT
TCAGCGATTGGCCCGGCGTTAAAAATGCATTTCGATTTGCGTAAAGATGTACGTGGTCAA
TTTATGGCCCGCCAGGACACGCTGCTTTCCCTCGCTAATGTTCATGCCATCAATGAAAAC
GGGCAGAGTTCCGTGGATATCGACAGGATTAATCACCAAACCGTGAATGTCGAAGCAGTG
AATTTTTCGCTGCCGAAGCGGGGAGGGTAA
>GENO.0321.00001.0002i_00005 774 hisP | Histidine transport ATP-binding protein HisP | NA | similar to AA sequence:UniProtKB:P02915 | COG:COG4598
ATGTCAGAAAATAAATTACACGTTATCGATTTGCACAAACGCTACGGCGGTCATGAAGTG
CTGAAAGGGGTATCGCTGCAGGCCCGCGCCGGAGATGTGATTAGCATCATCGGCTCGTCC
GGCTCCGGTAAAAGCACTTTTTTGCGCTGTATTAACTTCCTCGAAAAACCGAGCGAAGGC
GCGATTATCGTGAACGGTCAGAACATTAATCTGGTGCGCGACAAAGATGGGCAGCTCAAA
GTGGCGGATAAAAATCAGCTACGCTTGTTGCGTACCCGCCTGACGATGGTGTTTCAGCAC
TTCAACCTCTGGAGCCACATGACGGTGCTGGAAAATGTGATGGAAGCGCCGATTCAGGTA
CTGGGATTAAGCAAGCACGACGCGCGCGAGCGGGCGTTGAAATATCTGGCGAAGGTGGGG
ATTGATGAGCGCGCTCAGGGCAAATATCCCGTCCATCTCTCCGGCGGCCAACAGCAGCGC
GTTTCTATTGCGCGCGCGCTGGCGATGGAACCTGACGTTTTACTGTTCGATGAACCCACA
TCGGCGCTCGATCCTGAACTGGTCGGCGAAGTGTTGCGCATCATGCAACAACTGGCGGAA
GAAGGCAAAACGATGGTGGTGGTCACGCATGAAATGGGCTTCGCTCGCCATGTCTCTTCG
CACGTTATTTTTCTGCATCAGGGGAAAATTGAAGAAGAGGGTGATCCGGAGCAGGTGTTC
GGCAATCCGCAAAGCCCGCGTTTACAGCAATTCCTGAAAGGCTCGCTGAAATAA
>GENO.0321.00001.0002i_00006 735 trmD_1 | tRNA (guanine-N(1)-)-methyltransferase | 2.1.1.228 | similar to AA sequence:UniProtKB:P0A873 | COG:COG0336
ATGTTCCGCGCAATTACCGATTACGGGGTAACTGGCCGGGCAGTAAAAAAAGGCCTGCTG
AACATCCAAAGCTGGAGTCCTCGCGACTTCGCGCATGACCGGCACCGTACCGTGGACGAC
CGTCCTTACGGCGGCGGACCGGGGATGTTAATGATGGTGCAACCCTTGCGGGACGCCATT
CACGCAGCAAAAGCCGCGGCAGGTGAAGGCGCTAAAGTGATTTATCTGTCGCCTCAGGGA
CGCAAGCTTGATCAAGCGGGCGTTAGCGAGCTGGCCACGAATCAGAAGCTTATTCTGGTG
TGTGGTCGCTACGAAGGCGTAGATGAGCGCGTAATTCAGACCGAAATTGACGAAGAATGG
TCAATTGGCGATTACGTTCTCAGCGGTGGCGAACTACCGGCAATGACGCTGATTGACTCC
GTCGCCCGGTTTATACCGGGGGTTCTGGGGCATGAGGCATCAGCAATCGAAGATTCGTTT
GCTGATGGGTTGCTGGATTGTCCGCACTATACGCGCCCTGAAGTGTTAGAGGGGATGGAA
GTACCGCCAGTATTGCTGTCGGGAAACCATGCTGAGATACGTCGCTGGCGTTTGAAACAG
TCGCTGGGCCGAACCTGGCTTAGAAGACCTGAACTTCTGGAAAACCTGGCTCTGACTGAA
GAGCAAGCAAGGTTGCTGGCGGAGTTCAAAACAGAACACGCACAACAGCAGCATAAACAT
GATGGGATGGCATAG
>GENO.0321.00001.0002i_00007 828 trmD_2 | tRNA (guanine-N(1)-)-methyltransferase | 2.1.1.228 | similar to AA sequence:UniProtKB:P0A873 | COG:COG0336
ATGATGGGATGGCATAGCCGTCATATGGGCTCTCAGAGGAGACGCGCTAATGCGCAGTAC
GTGTTTATTGGCATAGTTAGCCTGTTTCCTGAAATGTTCCGCGCAATTACCGATTACGGG
GTAACTGGCCGGGCAGTAAAAAAAGGCCTGCTGAACATCCAAAGCTGGAGTCCTCGCGAC
TTCGCGCATGACCGGCACCGTACCGTGGACGACCGTCCTTACGGCGGCGGACCGGGGATG
TTAATGATGGTGCAACCCTTGCGGGACGCCATTCACGCAGCAAAAGCCGCGGCAGGTGAA
GGCGCTAAAGTGATTTATCTGTCGCCTCAGGGACGCAAGCTTGATCAAGCGGGCGTTAGC
GAGCTGGCCACGAATCAGAAGCTTATTCTGGTGTGTGGTCGCTACGAAGGCGTAGATGAG
CGCGTAATTCAGACCGAAATTGACGAAGAATGGTCAATTGGCGATTACGTTCTCAGCGGT
GGCGAACTACCGGCAATGACGCTGATTGACTCCGTCGCCCGGTTTATACCGGGGGTTCTG
GGGCATGAGGCATCAGCAATCGAAGATTCGTTTGCTGATGGGTTGCTGGATTGTCCGCAC
TATACGCGCCCTGAAGTGTTAGAGGGGATGGAAGTACCGCCAGTATTGCTGTCGGGAAAC
CATGCTGAGATACGTCGCTGGCGTTTGAAACAGTCGCTGGGCCGAACCTGGCTTAGAAGA
CCTGAACTTCTGGAAAACCTGGCTCTGACTGAAGAGCAAGCAAGGTTGCTGGCGGAGTTC
AAAACAGAACACGCACAACAGCAGCATAAACATGATGGGATGGCATAG
>GENO.0321.00001.0002i_00008 465 NA | hypothetical protein | NA | NA | NA
ATGAAGTTTGTTGCGCCCGAACAGGCACCGGAACAGGCGGAGGTCATCAAAAATACGCCG
TTCTGGCCTGATGTGGACCTGTCGGAATTTCGCAGTGTGATGCGCACTGACGGCACGGTG
ACGCAGCCGCGTTTAAAGCAGGTCGTGCTGACGGCGATCTCTGAGGTTAACGCTGAGCTG
TACGACTTCCGCAACCGTCAGCAGATGCTGGGCTGGCGGACACTTGCTGAGGTTCCCGCA
GAAATGCTGGACGGTAAAAGCGAGCGTATCCGGCACTACCACAACGCTGTTTTTTGCTGG
GCGCGCGCTGTGCTTAATGAGCGTTATCAGGACTATGACGCCACGGCGTCAGGCGTGAAG
CGAGGGGAGGAGCTGGCGGAGGCCAGCGGCGATCTGTGGCGTGATGCCCGCTGGGCCATC
AGCCGGGTGCAGGATGTACCGCACTGTACGGTGGAGCTTATCTGA
>GENO.0321.00001.0002i_00009 261 NA | hypothetical protein | NA | NA | NA
ATGGCCGGGTTGCACGCGCCATATGCATATAGCGCGCATCATGCGGTGAATTTCTGTTCT
GAGTATAAACGTGGCTTTGTATTGGGTTTTACACACCGTATGTTCGAAAAGACCGGCGAT
CGTCAACTTAGCGCGTGGGAGGCTGGAATTCTGACGCGTCGCTATGGTCTGGATAAAGAA
ATGGTGATGGATTTCTTTAAAGAGAATCATTCCGGGATGGCGGTTCGCTTCTTTATGGCC
GGTTATCGACTCGAAGGTTGA
>GENO.0321.00001.0002i_00010 582 NA | hypothetical protein | NA | NA | NA
ATGTCTACGCTTCTCTATTTGCACGGATTCAACAGTTCCCCTCGCTCGGCAAAAGCGTGC
CAGCTAAAAAACTGGCTGGCGGAGCGTCATCCGCATGTTGAGATGATCGTCCCTCAGCTG
CCGCCGTATCCTGCCGATGCGGCGGAGTTGCTGGAATCTCTCGTGCTTGAGCATGGCGGT
GCGCCATTAGGGCTGGTAGGATCGTCGCTGGGTGGTTATTACGCCACCTGGCTGTCGCAA
TGTTTTATGCTGCCGGCTGTGGTGGTGAATCCCGCCGTGCGGCCCTTTGAATTACTGACC
GACTATCTCGGTCAGAACGAGAACCCCTACACCGGGCAGCAATATGTGCTAGAGTCTCGC
CATATTTATGATCTTAAAGTCATGCAGATTGACCCGCTGGAAGCGCCGGACCTGATCTGG
CTACTGCAACAGACGGGCGATGAAGTGCTGTATTACCGCCAGGCGGTGGCATATTACGCC
TCCTGCCGTCAGACAGTGACCGAGGGTGGTAATCACGCATTCACGGGCTTCGAAGATTAT
TTCAACCAGATTGTCGATTTTCTTGGACTGCACAGTTGCTGA
>GENO.0321.00001.0002b_00011 1308 dctM | C4-dicarboxylate TRAP transporter large permease protein DctM | NA | similar to AA sequence:UniProtKB:O07838 | COG:COG1593
ATGATTGACCCTATTTTTGCGTCCTGTACGCTAATTGCCGTCTTTGTTGTTTTACTGGCC
ATGGGCGCGCCTATCGGGATCTGCATCGTTATCGCCTCTTTCAGCACCATGATGCTGGTA
CTGCCTTTCGATATTTCGATGTTCGCCACCGCGCAAAAAATGTTCTCCAGCCTGGACAGT
TTTGCCTTGCTGGCCGTGCCGTTCTTCGTTTTGTCCGGGGTGATCATGAATAGCGGGGGA
ATTGCCGCCCGGCTGGTCAATTTTGCCAAACTGTTTACTGGCAAACTGCCCGGCTCGCTC
TCTTATACCAACATCGTCGGCAATATGATGTTCGGTGCAATTTCCGGATCGGCGATTGCC
GCCTCAACCTCCATCGGCGGCGTGATGGTGCCGATGAGCGCGCGCGAAGGTTACGATCGC
GGCTTTGCGGCCGCGGTGAATATCGCCTCCGCGCCGACGGGAATGTTAATTCCGCCCACC
ACGGCTTTTATCCTTTACGCGCTGGCAAGCGGGGGAACATCGATTGCCGCTCTGTTCGCC
GGCGGTCTGGTCGCGGGAGTGCTGTGGGGCGTTGGCTGTATGCTGGTCACGCTGGTGGTC
GCTAAGCGTCGAAATTATCGGGTTTTCTTCACCGTCCAAAAAGGTATGGCGCTAAAAGTT
GCCGTTGAGGCCATTCCCAGCCTGCTGCTGATCGTGATTATTGTCGGCGGCATTGTGCAG
GGGATTTTCACCGCCATTGAAGCCTCCGCGATTGCCGTGGTGTATACGTTATTGCTGACG
ATGGTGTTTTACCGCACGCTGAAAATTAAGGATTTGCCTTCGATTTTGCTCCAGACAGTG
GTAATGACCGGGGTCATCATGTTCCTGCTGGCAACCTCTTCGGCGATGTCCTTCTCGATG
TCGATCACCAATATTCCTGCGGCGCTGAGCGATATGATCCTCGGTATTTCCGCCAATAAA
CTGGTTATCCTGTTAGTCATTACCGTCTTTTTGTTGATTATCGGCGCATTTATGGATATT
GGTCCGGCCATTCTGATTTTTACCCCGATTCTGCTGCCAATCATGGCTAAACTGGGCGTC
GATCCGGTGCATTTCGGCATTATCATGATCTATAACCTGGCGATTGGCACCATTACGCCG
CCAGTTGGCAGTGGTTTATATGTCGGGGCGAGCGTCGGTAAGGTCAAAGTTGAGGAAGTG
ATTAAACCGTTGCTGCCTTTTTACGGCGCGATTATCGGCGTTCTGTTATTAATTACCTAC
ATTCCGGAAATCACACTGTTCTTACCCCGTCTACTGGGCATCATGTAA
>GENO.1216.00002.0001b_00001 831 amiD_1 | N-acetylmuramoyl-L-alanine amidase AmiD | 3.5.1.28 | similar to AA sequence:UniProtKB:P75820 | COG:COG3023
ATGAGAGCGCTACTGTGGCTGGTGGGTCTTGCGTTGCTGTTAACAGGCTGCGCGAGCGAA
AAAGGAATTATCGATGAAGAGGGATATCAGCTTGATACCCGACATCGGGCGCAGGCGGCC
TATCCGCGCATTAAAGTCCTGGTGATTCACTATACGGCGGAAAACTTTGACGTTTCGCTG
GCGACGTTAACGGGCCGCAACGTCAGTTCGCATTACCTGATTCCCGCAACCCCGCCATTA
TATGGCGGTAAACCGCGCATCTGGCAACTGGTGCCGGAACAGGATCAGGCCTGGCATGCG
GGCGTCAGTTTCTGGCGAGGCGCCACGCGTCTCAATGATACGTCTATTGGCATTGAGCTG
GAAAATCGCGGCTGGCGAATGTCCGGCGGGGTGAAATCTTTCGCGCCGTTTGAATCCGCG
CAAATTCAGGCATTGATTCCGTTAGCGAAGGACATTATCGCGCGCTATGACATCAAACCG
CAGAATGTGGTGGCCCATGCGGATATCGCGCCGCAGCGTAAAGACGATCCCGGCCCGCGC
TTCCCGTGGCGCGAGCTGGCGGCACAGGGGATTGGCGCCTGGCCTGACGCCCAGCGTGTG
GCGTTTTATCTGGCTGGACGCGCGCCGTATACGCCAGTCGATACCGCAACGGTGCTTGCG
TTACTCTCGCGCTATGGCTATGAAGTCAAAGCCGATATGACGGCGCGCGAGCAACAGCGG
GTGATTATGGCGTTCCAGATGCACTTCCGTCCGGCGCAATGGAACGGTATCGCAGATGCC
GAAACGCAGGCGATTGCCGAAGCATTACTGGAGAAGTACGGCCAGGATTAA
>GENO.1216.00002.0001i_00002 831 amiD_2 | N-acetylmuramoyl-L-alanine amidase AmiD | 3.5.1.28 | similar to AA sequence:UniProtKB:P75820 | COG:COG3023
ATGAGAGCGCTACTGTGGCTGGTGGGTCTTGCGTTGCTGTTAACAGGCTGCGCGAGCGAA
AAAGGAATTATCGATGAAGAGGGATATCAGCTTGATACCCGACATCGGGCGCAGGCGGCC
TATCCGCGCATTAAAGTCCTGGTGATTCACTATACGGCGGAAAACTTTGACGTTTCGCTG
GCGACGTTAACGGGCCGCAACGTCAGTTCGCATTACCTGATTCCCGCAACCCCGCCATTA
TATGGCGGTAAACCGCGCATCTGGCAACTGGTGCCGGAACAGGATCAGGCCTGGCATGCG
GGCGTCAGTTTCTGGCGAGGCGCCACGCGTCTCAATGATACGTCTATTGGCATTGAGCTG
GAAAATCGCGGCTGGCGAATGTCCGGCGGGGTGAAATCTTTCGCGCCGTTTGAATCCGCG
CAAATTCAGGCATTGATTCCGTTAGCGAAGGACATTATCGCGCGCTATGACATCAAACCG
CAGAATGTGGTGGCCCATGCGGATATCGCGCCGCAGCGTAAAGACGATCCCGGCCCGCGC
TTCCCGTGGCGCGAGCTGGCGGCACAGGGGATTGGCGCCTGGCCTGACGCCCAGCGTGTG
GCGTTTTATCTGGCTGGACGCGCGCCGTATACGCCAGTCGATACCGCAACGGTGCTTGCG
TTACTCTCGCGCTATGGCTATGAAGTCAAAGCCGATATGACGGCGCGCGAGCAACAGCGG
GTGATTATGGCGTTCCAGATGCACTTCCGTCCGGCGCAATGGAACGGTATCGCAGATGCC
GAAACGCAGGCGATTGCCGAAGCATTACTGGAGAAGTACGGCCAGGATTAA
>GENO.1216.00002.0001i_00003 474 hpcD | 5-carboxymethyl-2-hydroxymuconate Delta-isomerase | 5.3.3.10 | similar to AA sequence:UniProtKB:Q05354 | NA
ATGCCGAAACGCAGGCGATTGCCGAAGCATTACTGGAGAAGTACGGCCAGGATTAACAGG
GCGCGGTATCGCGAGGACTCTCTCTTCGAGGACATGCCGCACTTTATTGCTGAATGTACT
GAAAATATTCGCGAGCAGGCTGATTTACCCGGCCTGTTCAGCAAGGTAAACGAGGCGCTG
GCCGCCAGCGGGATTTTCCCCATCGGCGGTATCCGCAGTCGCGCCCACTGGCTGGATACC
TGGCAGATGGCTGACGGTAAGCATGATTACGCGTTTGTGCATATGACGCTGAAAATCGGC
GCCGGGCGCAGCCTGGAGAGCCGTCAGGAAGTCGGCGAAATGCTGTTCGGGCTGATTAAA
GCCCACTTCGCCGACCTGATGGAGAACCGCTATCTGGCGCTGTCGTTTGAGATTGCCGAG
TTACATCCAACGCTCAATTACAAACAAAACAACGTACACGCGTTATTTAAATAG
>GENO.1216.00002.0001i_00004 225 pspB | Phage shock protein B | NA | similar to AA sequence:UniProtKB:P0AFM9 | NA
ATGAGCGCGCTATTTCTGGCCATCCCGTTAACCATTTTTGTGTTGTTTGTGTTACCGATT
TGGCTGTGGCTGCATTACAGCAACCGCGCCGGTCGGGGAGAACTGTCGCAAAGCGAGCAG
CAACGCTTACTGCAACTCACAGACGACGCGCAACGTATGCGCGAGCGCATTCAGGCGCTG
GAAGACATTCTTGATGCAGAGCATCCGAACTGGAGAGAGCGCTAA
>GENO.1216.00002.0001i_00005 1404 NA | hypothetical protein | NA | NA | NA
ATGCCCGCGACTAAATTCTCCCGACGTACCCTCCTGACGGCAGGTTCTGCGCTTGCTGTT
CTTCCTTTCCTGCGCGCCTTGCCGGTACAGGCGCGTGAACCTCGCGAGACCGTCGATATT
AAGGATTATCCGGCGGATGACGGTATCGCCTCGTTCAAACAGGCCTTCGCCGACGGACAG
ACCGTGGTCGTACCGCCAGGATGGGTGTGTGAAAATATCAATGCGGCGATAACGATTCCG
GCGGGAAAAACGCTGCGGGTACAGGGCGCGGTGCGTGGGAATGGCCGGGGACGGTTTATT
TTGCAGGACGGGTGTCAGGTGGTGGGGGAGCAGGGCGGCAGTCTGCACAATGTGACGCTG
GATGTTCGCGGGTCGGACTGTGTGATTAAAGGCGTGGCGATGAGCGGCTTTGGCCCCGTC
GCGCAAATTTTCATCGGTGGTAAGGAACCGCAGGTGATGCGTAATCTCATTATCGATGAC
ATCACCGTTACCCACGCCAACTACGCCATTCTCCGCCAGGGATTTCATAACCAAATGGAC
GGCGCGAGGATTACGCATAGCCGCTTTAGCGATTTACAGGGGGACGCCATTGAGTGGAAT
GTCGCGATTCACGACCGCGATATCCTGATTTCCGATCATGTCATCGAACGCATTGATTGT
ACCAATGGCAAAATCAACTGGGGGATCGGCATCGGGCTGGCGGGTAGCACCTATGACAAC
AGTTATCCTGAAGACCAGGCAGTAAAAAACTTTGTGGTGGCCAATATTACCGGATCTGAT
TGCCGACAGCTTGTGCACGTAGAAAATGGCAAACATTTCGTCATTCGCAATGTCAAAGCC
AAAAACATCACGCCCGATTTCAGTAAAAATGCGGGTATTGATAACGCAACGATCGCAATT
TATGGCTGTGATAATTTCGTCATTGATAATATTGATATGACGAATAGTGCCGGGATGCTC
ATCGGCTATGGCGTCGTTAAAGGAAAATACCTGTCAATTCCGCAAAACTTTAAATTAAAC
GCTATTCGGTTGGATAATCGCCAGGTTGCTTATAAATTACGCGGCATTCAAATTTCCTCC
GGCAACACCCCCTCTTTTGTCGCCATCACCAATGTACGGATGACGCGTGCTACGCTGGAA
CTGCATAATCAACCGCAGCACCTCTTCCTGCGTAATATCAACGTGATGCAAACTTCAGCG
ATTGGCCCGGCGTTAAAAATGCATTTCGATTTGCGTAAAGATGTCCGTGGTCAATTTATG
GCCCGCCAGGACACGCTGCTTTCCCTCGCTAATGTTCATGCCATCAATGAAAACGGGCAG
AGTTCCGTGGATATCGACAGGATTAATCACCAAACCGTGAATGTCGAAGCAGTGAATTTT
TCGCTGCCGAAGCGGGGAGGGTAA
>GENO.1216.00002.0001i_00006 774 hisP | Histidine transport ATP-binding protein HisP | NA | similar to AA sequence:UniProtKB:P02915 | COG:COG4598
ATGTCAGAAAATAAATTACACGTTATCGATTTGCACAAACGCTACGGCGGTCATGAAGTG
CTGAAAGGGGTATCGCTGCAGGCCCGCGCCGGAGATGTGATTAGCATCATCGGCTCGTCC
GGCTCCGGTAAAAGCACTTTTTTGCGCTGTATTAACTTCCTCGAAAAACCGAGCGAAGAC
GCGATTATCGTGAACGGTCAGAACATTAATCTGGTGCGCGACAAAGACGGGCAGCTCAAA
GTGGCGGATAAAAATCAGCTACGCTTGTTGCGTACCCGCCTGACGATGGTGTTTCAGCAC
TTTAACCTCTGGAGCCACATGACGGTGCTGGAAAATGTGATGGAAGCGCCGATTCAGGTA
CTGGGATTAAGCAAGCACGACGCGCGCGAGCGGGCGTTGAAATATCTGGCGAAGGTGGGG
ATTGATGAGCGCGCTCAGGGCAAATATCCCGTTCATCTCTCCGGTGGCCAACAGCAGCGC
GTTTCTATTGCGCGCGCGCTGGCGATGGAACCTGACGTTTTACTGTTCGATGAACCCACT
TCGGCGCTCGATCCTGAACTGGTCGGCGAAGTGTTGCGCATCATGCAACAACTGGCGGAA
GAAGGCAAAACGATGGTGGTGGTCACGCATGAAATGGGCTTCGTTCGCCATGTCTCTTCG
CACGTTATTTTTCTGCATCAGGGGAAAATTGAAGAAGAGGGCGATCCGGAGCAGGTGTTC
GGCAATCCGCAAAGCCCGCGTTTACAGCAATTCCTGAAAGGCTCGCTGAAATAA
>GENO.1216.00002.0001i_00007 792 trmD | tRNA (guanine-N(1)-)-methyltransferase | 2.1.1.228 | similar to AA sequence:UniProtKB:P0A873 | COG:COG0336
ATGCGCGCGATATATCGGCGATGCGTGTTTATTGGCATCGTTAGCCTGTTTCCTGAAATG
TTCCGCGCAATTACCGATTACGGGGTAACTGGCCGGGCAGTAAAAAATGGCCTGCTGAAC
ATCCAAAGCTGGAGTCCTCGCGACTTCACGCATGACCGGCACCGTACCGTGGACGATCGT
CCTTACGGCGGCGGACCAGGGATGTTAATGATGGTGCAACCCTTGCGGGACGCCATTCAC
GCAGCAAAAGCCGCGGCAGGTGAAGGCGCTAAAGTGATTTATCTGTCGCCTCAGGGACGC
AAGCTTGATCAAGCGGGCGTTAGCGAGCTGGCCACGAATCAGAAGCTTATTCTGGTGTGT
GGTCGCTACGAAGGCGTAGATGAGCGCGTAATTCAGACCGAAATTGACGAAGAATGGTCA
ATTGGCGATTACGTTCTCAGCGGTGGCGAACTACCGGCAATGACGCTGATTGACTCCGTC
GCCCGGTTTATACCGGGAGTTCTGGGGCATGAAGCATCAGCAATCGAAGATTCGTTTGCT
GATGGGTTGCTGGATTGTCCGCACTATACGCGCCCTGAAGTGTTAGAGGGGATGGAAGTA
CCGCCAGTATTGCTGTCGGGAAACCATGCTGAGATACGTCGCTGGCGTTTGAAACAGTCG
CTGGGCCGAACCTGGCTTAGAAGACCTGAACTTCTGGAAAACCTGGCTCTGACTGAAGAG
CAAGCAAGGTTGCTGGCGGAGTTCAAAACAGAACACGCACAACAGCAGCATAAACATGAT
GGGATGGCATAG
>GENO.1216.00002.0001b_00008 288 NA | hypothetical protein | NA | NA | NA
ATGAATAATCATTTTGGGAAAGGGTTAATGGCCGGGTTGCACGCGCCATATGCATATAGC
GCGCATCATGCGGTGAATTTCTGTTCTGAGTATAAACGTGGCTTTGTATTGGGTTTTACA
CACCGTATGTTCGAAAAGACCGGCGATCGTCAACTTAGCGCGTGGGAGGCTGGAATTCTG
ACGCGTCGCTATGGTCTGGATAAAGAAATGGTGATGGATTTCTTTAAAGAGAATCATTCC
GGGATGGCGGTTCGCTTCTTTATGGCCGGTTATCGACTCGAAGGTTGA
>GENO.1216.00002.0002b_00009 582 NA | hypothetical protein | NA | NA | NA
ATGTCTACGCTTCTCTATTTGCACGGATTCAACAGTTCCCCTCGCTCGGCAAAAGCGTGC
CAGCTAAAAAACTGGCTGGCGGAGCGTCATCCGCATGTTGAGATGATCGTCCCTCAACTA
CCGCCGTATCCTGCCGATGCGGCGGAGTTGCTGGAGTCTCTCGTGCTTGAGCATGGCGGT
GCGCCATTAGGGCTGGTAGGATCGTCGCTGGGTGGTTATTACGCCACCTGGCTGTCGCAA
TGTTTTATGCTGCCGGCTGTGGTGGTGAATCCCGCCGTGCGGCCCTTTGAATTACTGACC
GACTATCTCGGTCAGAACGAGAACCCCTACACCGGGCAGCAATATGTGCTAGAGTCTCGC
CATATTTATGATCTTAAAGTCATGCAGATTGACCCGCTGGAAGCGCCGGACCTGATCTGG
CTACTGCAACAGACGGGCGATGAAGTGCTGGATTACCGCCAGGCGGTGGCATATTACGCC
TCCTGCCGTCAGACAGTGACCGAGGGTGGTAATCACGCATTCACGGGCTTCGAAGATTAT
TTCAACCAGATTGTCGATTTTCTTGGACTGCACAGTTGCTGA
>GENO.1216.00002.0002b_00010 1308 dctM | C4-dicarboxylate TRAP transporter large permease protein DctM | NA | similar to AA sequence:UniProtKB:O07838 | COG:COG1593
ATGATTGACCCTATTTTTGCGTCCTGTACGCTAATTGCCGTCTTTGTTGTTTTACTGGCC
ATGGGCGCGCCTATCGGGATCTGCATCGTTATCGCCTCTTTCAGCACCATGATGCTGGTA
CTGCCTTTCGATATTTCGATGTTCGCCACCGCGCAAAAAATGTTCTCCAGCCTGGACAGT
TTTGCCTTGCTGGCCGTGCCGTTCTTCGTTTTGTCCGGGGTGATCATGAATAGCGGGGGA
ATTGCCGCCCGGCTGATCAATTTTGCCAAACTGTTTACTGGCAAACTGCCCGGTTCGCTC
TCTTATACCAACATCGTCGGCAATATGATGTTCGGTGCAATTTCCGGATCGGCAATTGCC
GCCTCAACCTCCATCGGCGGCGTGATGGTGCCGATGAGCGCGCGCGAAGGTTACGATCGC
GGCTTTGCGGCCGCGGTGAATATCGCCTCCGCGCCGACGGGAATGTTAATTCCGCCCACC
ACGGCTTTTATCCTTTATGCGCTGGCAAGCGGGGGAACATCGATTGCCGCTCTGTTCGCC
GGCGGTCTGGTCGCGGGAGTGCTGTGGGGCGTTGGCTGTATGCTGGTCACGCTGGTAGTC
GCTAAGCGTCGAAATTATCGGGTTTTCTTCACCGTCCAAAAAGGCATGGCGCTAAAAGTT
GCCGTTGAGGCCATTCCCAGCCTGTTACTGATCGTGATTATCGTCGGCGGCATTGTGCAG
GGGATTTTCACCGCCATTGAAGCCTCCGCGATTGCCGTGGTGTATACGTTATTGCTGACG
ATGGTGTTTTACCGCACGCTGAAAATTAAGGATTTGCCTTCGATTTTGCTCCAGACAGTG
GTAATGACCGGGGTCATCATGTTCCTGCTGGCAACCTCTTCGGCGATGTCCTTCTCAATG
TCGATCACCAATATTCCTGCGGCGCTGAGCGATATGATCCTCGGTATTTCCGCCAATAAA
CTGGTTATCCTGTTAGTCATTACCGTCTTTTTGTTGATTATCGGCGCATTTATGGATATC
GGTCCGGCCATTCTGATTTTTACCCCGATTCTGCTGCCGATCATGGCTAAACTGGGCGTC
GATCCGGTGCATTTGGGCATTATCATGATCTATAACCTGGCGATTGGCACCATTACGCCG
CCAGTTGGCAGTGGTTTATATGTCGGGGCGAGCGTCGGTAAGGTCAAAGTTGAGGAAGTG
ATTAAACCGTTGCTGCCTTTTTACGGCGCGATTATCGGCGTTCTGTTATTAATTACCTAC
ATTCCGGAAATCATACTGTTCTTACCCCGTCTACTGGGCATCATGTAA
>GENO.1216.00002.0003b_00011 255 NA | hypothetical protein | NA | NA | NA
ATGATAATTAATGGGAAATTAATTAAAGCAAAAGACTTAGCTAAGGCTGCAGGTGTATCT
CGTTCAACAGTGATTAAATATTACGGCATTAGCCGTGAGAATTACGAAAGGGTAGCAACT
GAAAGAAGGAAGCTTGCTTTTGAACTAAGAGCATCAGGTTTAAAATGGAAAGAAGTTGCT
GAAAAAATGAACACGACAAAATATAGCGCAATTGCATATTATAGACGATATTTAGCATTA
GAGAAAAACAAATAA
>GENO.1216.00002.0003b_00012 780 NA | IS21 family transposase ISSen3 | NA | similar to AA sequence:ISfinder:ISSen3 | NA
ATGGTCGAACTGCAACATCAACGGCTGATGGTGCTTGCCGAACAGCTCCAGCTGGACAGT
CTTATCGGCGCAGCGCCGGCGCTGTCGCAACAGGCGGTGGATCAGGAATGGAGCTACATG
GACTTCCTGGAGCACCTGTTACATGAGGAGAAACTGGCCCGGCATCAGCGTAAACAGGCG
ATGTACACGCGGATGGCAGCCTTCCCGGCGGTAAAGACGTTCGAGGAGTACGACTTCACC
TTCGCCACCGGCGCTCCTCAGAAGCAAATCCAGTCGCTGCGATCCCTGAGCTTCATAGAG
CGTAACGAAAACATCGTGTTGCTGGGGCCATCGGGCGTGGGAAAAACGCATCTGGCGATA
GCCATGGGCTACGAAGCAGTACGGGCGGGCATCAAGGTTCGCTTCACAACAGCAGCGGAC
CTGCTGCTACAGCTGTCCACTTCACAGCGTCAGGGCCGTTACAAAACGACTCTCAATCGT
GGTGTCATGGCCCCGAAGCTGCTTATCATCGATGAAATAGGTTATCTGCCGTTCAGTCAG
GAGGAAGCCAAGCTGTTCTTCCAGGTCATCGCCAAACGTTACGAGAAGAGCGCGATGATC
CTGACCTCCAACCTGCCGTTCGGGCAGTGGGATCAGACGTTCGCCGGTGATGCAGCGCTG
ACATCGGCGATGCTGGACCGGATCTTACATCACTCACACGTCGTGCAAATAAAAGGGGAA
AGCTATCGACTGAAGCAGAAACGAAAGGCCGGGGTTATAGCTGAAGCTAATCCTGAGTAA
gembase_name orig_name to_annotate gsize nb_conts L90
GEN4.1111.00001 genome4.fst Examples/input_files/pan-init-files/tmp_files/genome4.fst_prokka-split5N.fna 7134 1 1
GENO.0321.00001 genome1.fst Examples/input_files/pan-init-files/tmp_files/genome1.fst_prokka-split5N.fna 9808 2 2
GENO.1216.00002 genome3-chromo.fst-all.fna Examples/input_files/pan-init-files/tmp_files/genome3-chromo.fst-all.fna_prokka-split5N.fna 8817 3 3
>GEN4.1111.00001.0001b_00001 831 amiD | N-acetylmuramoyl-L-alanine amidase AmiD | 3.5.1.28 | similar to AA sequence:UniProtKB:P75820 | COG:COG3023
MKALLWLVGLALLLTGCASEKGIIDKEGYQLDTRHRAQAAYPRIKVLVIHYTAENFDVSL
ATLTGRNVSSHYLIPATPPLYGGKPRIWQLVPEQDQAWHAGVSFWRGATRLNDTSIGIEL
ENRGWRMSGGVKSFAPFESAQIQALIPLAKDIIARYDIKPQNVVAHADIAPQRKDDPGPR
FPWRELAAQGIGAWPDAQRVAFYLAGRAPYTPVDTATVLALLSRYGYEVKADMTAREQQR
VIMAFQMHFRPAQWNGIADAETQAIAEALLEKYGQD
>GEN4.1111.00001.0001i_00002 381 hpcD | 5-carboxymethyl-2-hydroxymuconate Delta-isomerase | 5.3.3.10 | similar to AA sequence:UniProtKB:Q05354 | NA
MPHFIAECTENIREQADLPGLFSKVNEALAASGIFPIGGIRSRAHWLDTWQMADGKHDYA
FVHMTLKIGTGRSLESRQEVGEMLFGLIKAHFADLMENRYLALSFEIAELHPTLNYKQNN
VHALFK
>GEN4.1111.00001.0001i_00003 804 hpcG | 2-oxo-hept-4-ene-1,7-dioate hydratase | 4.2.1.163 | similar to AA sequence:UniProtKB:P42270 | NA
MLDKQTHTLIAQRLNQAEKQREQIRAVSLDYPNITIEDAYAVQREWVNIKIAEGRTLKGH
KIGLTSKAMQASSQISEPDYGALLDDMFFHDGGDIPTDRFIVPRIEVELAFVLAKPLRGP
HCTLFDVYNATDYVIPALELIDARSHNIDPETQRPRKVFDTISDNAANAGVILGGRPIKP
DELDLRWISALLYRNGVIEETGVAAGVLNHPANGVAWLANKLAPYDVQLEAGQIILGGSF
TRPVPASKGDTFHVDYGNMGAISCRFV
>GEN4.1111.00001.0001i_00004 1404 NA | hypothetical protein | NA | NA | NA
MPVNKFSRRTLLTAGSALAVLPFLRALPVQAREPRETVDIKDYPADDGIASFKQAFADGQ
TVVLPPGWVCENINAAITIPAGKTLRVQGAVRGNGRGRFILQDGCQVVGEQGGSLHNVTL
DVRGSDCVIKGVTMSGFGPVAQIFIGGKEPQVMRNLIIDDITVTHANYAILRQGFHNQMD
GARITHSRFSDLQGDAIEWNVAIHDRDILISDHVIERIDCTNGKINWGIGIGLAGSTYDN
SYPEDQAVKNFVVANITGSDCRQLVHVENGKHFVIRNVKAKNITPDFSKNAGIDNATIAI
YGCDNFVIDNIDMTNSAGMLIGYGVVKGKYLSIPQNFKLNAIRLDNRQVAYKLRGIQISS
GNIPSFVAITNVRMTRATLELHNQPQHLFLRNINVMQTSAIGPALKMHFDLRKDVRGQFM
ARQDTLLSLANVHAINENGQSSVDIDRINHQTVNVEAVNFSLPKRGG
>GEN4.1111.00001.0001i_00005 774 hisP | Histidine transport ATP-binding protein HisP | NA | similar to AA sequence:UniProtKB:P02915 | COG:COG4598
MSENKLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
AIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVF
GNPQSPRLQQFLKGSLK
>GEN4.1111.00001.0001i_00006 768 trmD | tRNA (guanine-N(1)-)-methyltransferase | 2.1.1.228 | similar to AA sequence:UniProtKB:P0A873 | COG:COG0336
MFIGIVSLFPEMFRAITDYGVTGRAVKKGLLNIQSWSPRDFAHDRHRTVDDRPYGGGPGM
LMMVQPLRDAIHAAKAAAGEGAKVIYLSPQGRKLDQAGVSELATNQKLILVCGRYEGVDE
RVIQTEIDEEWSIGDYVLSGGELPAMTLIDSVARFIPGVLGHEASAIEDSFADGLLDCPH
YTRPEVLEGMEVPPVLLSGNHAEIRRWRLKQSLGRTWLRRPELLENLALTEEQARLLAEF
KTEHAQQQHKHDGMA
>GEN4.1111.00001.0001i_00007 261 NA | hypothetical protein | NA | NA | NA
MAGLHAPYAYSAHHAVNFCSEYKRGFVLGFTHRMFEKTGDRQLSAWEAGILTRRYGLDKE
MVMDFFKENHSGMAVRFFMVGYRLEG
>GEN4.1111.00001.0001i_00008 582 NA | hypothetical protein | NA | NA | NA
MSTLLYLHGFNSSPRSAKACQLKNWLAERHPHVEMIVPQLPPYPADAAELLESLVLEHGG
APLGLVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLTDYLGQNENPYTGQQYVLESR
HIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCRQTVTEGGNHAFTGFEDY
FNQIVDFLGLHSC
>GEN4.1111.00001.0001b_00009 1083 dctM | C4-dicarboxylate TRAP transporter large permease protein DctM | NA | similar to AA sequence:UniProtKB:O07838 | COG:COG1593
MNSGGIAARLVNFAKLFTGKLPGSLSYTNIVGNMMFGAISGSAIAASTSIGGVMVPMSAR
EGYDRGFAAAVNIASAPTGMLIPPTTAFILYALASGGTSIAALFAGGLVAGVLWGVGCML
VTLVVAKRRNYRVFFTVQKGMALKVAVEAIPSLLLIVIIVGGIVQGIFTAIEASAIAVVY
TLLLTMVFYRTLKIKDLPSILLQTVVMTGVIMFLLATSSAMSFSMSITNIPAALSDMILG
ISANKLVILLVITVFLLIIGAFMDIGPAILIFTPILLPIMAKLGVDPVHFGIIMIYNLAI
GTITPPVGSGLYVGASVGKVKVEEVIKPLLPFYGAIIGVLLLITYIPEITLFLPRLLGIM
>GENO.0321.00001.0001b_00001 1668 glnS | Glutamine--tRNA ligase | 6.1.1.18 | similar to AA sequence:UniProtKB:P00962 | COG:COG0008
MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYQG
QCNLRFDDTNPVKEDIEYVDSIKNDVEWLGFHWSGDIRYSSDYFDQLHAYAVELINKGLA
YVDELTPEQIREYRGTLTAPGKNSPFRDRSVEENLALFEKMRTGGFEEGKACLRAKIDMA
SPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDALEGITHSLCTLEFQDNRRL
YDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRR
GYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENAPRAMAVIDPVKLVIENYPQG
ESEMVTMPNHPNKPEMGSREVPFSGEIWIDRADFREEANKQYKRLVMGKEVRLRNAYVIK
AERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIHWVSAAHALPIEIRLYDRLFSV
PNPGAAEDFLSVINPESLVIKQGYGEPSLKAAVAGKAFQFEREGYFCLDSRYATADKLVF
NRTVGLRDTWAKAGE
>GENO.0321.00001.0001b_00002 831 amiD | N-acetylmuramoyl-L-alanine amidase AmiD | 3.5.1.28 | similar to AA sequence:UniProtKB:P75820 | COG:COG3023