diff --git a/CHANGELOG.md b/CHANGELOG.md index 92e29dbdddfc32faeaa779dd968316c3d8193f95..99a64c3e5f6b0660539d7010f936d9277a4fbba7 100644 --- a/CHANGELOG.md +++ b/CHANGELOG.md @@ -1,4 +1,4 @@ -## [0.0.21](https://gitlab.pasteur.fr/bis-aria/Ariaec/compare/0.1.0...0.0.21) (2019-07-05) +## [0.0.21](https://gitlab.pasteur.fr/bis-aria/Ariaec/compare/0.1.0...0.0.21) (2019-07-08) ### Bug Fixes diff --git a/PKG-INFO b/PKG-INFO index 0671076341ff5be72839de1ad7cdf3deeb05af8e..7241f738e36aa612401a649ab6dc8383116d16b7 100644 --- a/PKG-INFO +++ b/PKG-INFO @@ -1 +1 @@ -Version: 0.0.21 \ No newline at end of file +Version: 0.1.01 \ No newline at end of file diff --git a/docs/examples/bpt1/bpt1.rst b/docs/examples/bpt1/bpt1.rst index 211fd6c56e3babecc8aa54904b86daa50c2ce14b..4b327ffad95b70defe68ec3144f33d73549c0ddc 100644 --- a/docs/examples/bpt1/bpt1.rst +++ b/docs/examples/bpt1/bpt1.rst @@ -15,48 +15,50 @@ can be found in the ``docs`` folder or :download:`here <../../examples.tar.gz>`. Contact map analysis -------------------- +**Input** + .. code-block:: console - > ariaec maplot examples/bpt1/data/BPT1_BOVIN.fa examples/bpt1/data/BPT1_BOVIN.indextableplus examples/bpt1/data/BPT1_BOVIN.native.aligned.pdb examples/bpt1/data/BPT1_BOVIN_contacts.gremlin.out -o examples/bpt1/out -t pdb gremlin + (venv) [user@host examples] > ariaec maplot bpt1/data/BPT1_BOVIN.fa bpt1/data/BPT1_BOVIN.indextableplus bpt1/data/BPT1_BOVIN.native.aligned.pdb bpt1/data/BPT1_BOVIN_contacts.gremlin.out -o bpt1/out -t pdb gremlin **Output** .. code-block:: console - ================================================================================ - - ARIA Evolutive Contact toolbox - - ================================================================================ + ================================================================================ + + ARIA Evolutive Contact toolbox + + ================================================================================ + + INFO Initialize settings + INFO Making output directories + INFO Reading fasta file /c7/home/fallain/tmp/bpt1/data/bpt1_bovin.fa + INFO Amino acid sequence: FCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG + INFO Checking if file /c7/home/fallain/tmp/bpt1/data/BPT1_BOVIN.indextableplus correspond to indextableplus format + INFO Format type correct (indextableplus) + INFO Reading secondary structure file /c7/home/fallain/tmp/bpt1/data/BPT1_BOVIN.indextableplus [indextableplus] + INFO Loading ss dist file + INFO Reading distance file /c7/home/fallain/.conda/envs/aria/lib/python2.7/site-packages/aria/conbox/data/ss_dist.txt + INFO Align secondary structure sequence with protein sequence + INFO Reading /c7/home/fallain/tmp/bpt1/data/BPT1_BOVIN.native.aligned.pdb file + INFO Updating distance map with pdb file + INFO Generate contact map using contact definition defaultdict(None, {'default_cutoff': 8.0}) + INFO Using default cutoff + INFO Reading /c7/home/fallain/tmp/bpt1/data/BPT1_BOVIN_contacts.gremlin.out file + INFO Pdb map set as reference + INFO Generate contact map plot (/c7/home/fallain/tmp/bpt1/out/BPT1_BOVIN.maplot.pdf) + INFO Generate map report file (/c7/home/fallain/tmp/bpt1/out/mapreport) + INFO Generate roc file (/c7/home/fallain/tmp/bpt1/out/graphics/maplot.roc.csv) + INFO Generate roc plot (/c7/home/fallain/tmp/bpt1/out/graphics/maplot.roc.pdf) + INFO Generate precall file (/c7/home/fallain/tmp/bpt1/out/graphics/maplot.roc.csv) + INFO Generate precall plot (/c7/home/fallain/tmp/bpt1/out/graphics/maplot.precall.pdf) + INFO Generate contact file (/c7/home/fallain/tmp/bpt1/out/BPT1_BOVIN_contacts_gremlin.contact.txt) + INFO Generate stat file (/c7/home/fallain/tmp/bpt1/out/maplot.contactcmp.csv) + INFO Contact list: [(1, 39), (1, 42), (1, 51), (3, 22), (3, 25), (3, 45), (3, 47), (3, 51), (4, 23), (4, 38), (4, 39), (4, 42), (4, 49), (5, 23), (6, 19), (7, 37), (8, 12), (8, 31), (8, 33), (9, 19), (9, 34), (9, 37), (9, 41), (10, 33), (10, 36), (11, 33), (11, 35), (12, 8), (12, 20), (12, 31), (12, 33), (13, 33), (13, 34), (14, 31), (14, 33), (14, 36), (15, 31), (16, 29), (16, 31), (17, 41), (17, 43), (18, 28), (18, 29), (18, 45), (19, 6), (19, 9), (19, 28), (19, 29), (20, 12), (20, 25), (20, 27), (21, 28), (22, 3), (22, 25), (22, 28), (23, 4), (23, 5), (23, 26), (23, 29), (23, 43), (24, 28), (25, 3), (25, 20), (25, 22), (25, 28), (25, 46), (25, 53), (26, 23), (27, 20), (27, 48), (27, 52), (28, 18), (28, 19), (28, 21), (28, 22), (28, 24), (28, 25), (29, 16), (29, 18), (29, 19), (29, 23), (30, 33), (30, 37), (30, 38), (31, 8), (31, 12), (31, 14), (31, 15), (31, 16), (32, 37), (32, 38), (32, 40), (32, 41), (33, 8), (33, 10), (33, 11), (33, 12), (33, 13), (33, 14), (33, 30), (34, 9), (34, 13), (34, 37), (35, 11), (36, 10), (36, 14), (36, 39), (36, 50), (37, 7), (37, 9), (37, 30), (37, 32), (37, 34), (37, 41), (38, 4), (38, 30), (38, 32), (38, 41), (39, 1), (39, 4), (39, 36), (40, 32), (41, 9), (41, 17), (41, 32), (41, 37), (41, 38), (42, 1), (42, 4), (43, 17), (43, 23), (43, 47), (44, 47), (45, 3), (45, 18), (45, 49), (46, 25), (46, 49), (46, 50), (47, 3), (47, 43), (47, 44), (47, 51), (48, 27), (48, 52), (49, 4), (49, 45), (49, 46), (49, 53), (50, 36), (50, 46), (50, 53), (51, 1), (51, 3), (51, 47), (52, 27), (52, 48), (53, 25), (53, 49), (53, 50)] + INFO Generate contact map plot (/c7/home/fallain/tmp/bpt1/out/.maplot.pdf) + INFO Generate contact file (/c7/home/fallain/tmp/bpt1/out/BPT1_BOVIN_native_aligned.contact.txt) - INFO Initialize settings - INFO Making output directories - reading FASTA file examples/bpt1/data/BPT1_BOVIN.fa - INFO Amino acid sequence: FCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCG - INFO Checking if file examples/bpt1/data/BPT1_BOVIN.indextableplus correspond to indextableplus format - INFO Format type correct (indextableplus) - INFO Reading secondary structure file examples/bpt1/data/BPT1_BOVIN.indextableplus [indextableplus] - INFO Loading ss dist file - INFO Reading distance file ss_dist.txt - INFO Align secondary structure sequence with protein sequence - INFO Reader focused on file(s) ['examples/bpt1/data/BPT1_BOVIN.native.aligned.pdb', 'examples/bpt1/data/BPT1_BOVIN_contacts.gremlin.out'] ['pdb', 'gremlin'] - INFO Reading examples/bpt1/data/BPT1_BOVIN.native.aligned.pdb file - INFO Updating distance map with pdb file - INFO Generate contact map using contact definition defaultdict(None, {'bool': None, 'default_cutoff': 8.0}) - INFO Using default cutoff - INFO Reading examples/bpt1/data/BPT1_BOVIN_contacts.gremlin.out file - INFO Pdb map set as reference - INFO Generate contact map plot (examples/bpt1/out/BPT1_BOVIN.maplot.pdf) - INFO Generate contact file (examples/bpt1/out/BPT1_BOVIN_native_aligned.contact.txt) - INFO Generate map report file (examples/bpt1/out/mapreport) - INFO Generate roc file (examples/bpt1/out/graphics/maplot.roc.csv) - INFO Generate roc plot (examples/bpt1/out/graphics/maplot.roc.pdf) - INFO Generate precall file (examples/bpt1/out/graphics/maplot.roc.csv) - INFO Generate precall plot (examples/bpt1/out/graphics/maplot.precall.pdf) - INFO Generate contact file (examples/bpt1/out/BPT1_BOVIN_contacts_gremlin.contact.txt) - INFO Generate stat file (examples/bpt1/out/maplot.contactcmp.csv) - INFO Contact list: [(1, 39), (1, 42), (1, 51), (3, 22), (3, 25), (3, 45), (3, 47), (3, 51), (4, 23), (4, 38), (4, 39), (4, 42), (4, 49), (5, 23), (6, 19), (7, 37), (8, 12), (8, 31), (8, 33), (9, 19), (9, 34), (9, 37), (9, 41), (10, 33), (10, 36), (11, 33), (11, 35), (12, 8), (12, 20), (12, 31), (12, 33), (13, 33), (13, 34), (14, 31), (14, 33), (14, 36), (15, 31), (16, 29), (16, 31), (17, 41), (17, 43), (18, 28), (18, 29), (18, 45), (19, 6), (19, 9), (19, 28), (19, 29), (20, 12), (20, 25), (20, 27), (21, 28), (22, 3), (22, 25), (22, 28), (23, 4), (23, 5), (23, 26), (23, 29), (23, 43), (24, 28), (25, 3), (25, 20), (25, 22), (25, 28), (25, 46), (25, 53), (26, 23), (27, 20), (27, 48), (27, 52), (28, 18), (28, 19), (28, 21), (28, 22), (28, 24), (28, 25), (29, 16), (29, 18), (29, 19), (29, 23), (30, 33), (30, 37), (30, 38), (31, 8), (31, 12), (31, 14), (31, 15), (31, 16), (32, 37), (32, 38), (32, 40), (32, 41), (33, 8), (33, 10), (33, 11), (33, 12), (33, 13), (33, 14), (33, 30), (34, 9), (34, 13), (34, 37), (35, 11), (36, 10), (36, 14), (36, 39), (36, 50), (37, 7), (37, 9), (37, 30), (37, 32), (37, 34), (37, 41), (38, 4), (38, 30), (38, 32), (38, 41), (39, 1), (39, 4), (39, 36), (40, 32), (41, 9), (41, 17), (41, 32), (41, 37), (41, 38), (42, 1), (42, 4), (43, 17), (43, 23), (43, 47), (44, 47), (45, 3), (45, 18), (45, 49), (46, 25), (46, 49), (46, 50), (47, 3), (47, 43), (47, 44), (47, 51), (48, 27), (48, 52), (49, 4), (49, 45), (49, 46), (49, 53), (50, 36), (50, 46), (50, 53), (51, 1), (51, 3), (51, 47), (52, 27), (52, 48), (53, 25), (53, 49), (53, 50)] - INFO Generate contact map plot (examples/bpt1/out/.maplot.pdf) Setup diff --git a/docs/tutorial.rst b/docs/tutorial.rst index f4b5d31d6eac2a5f0d4cdd421ac8dec5897c7e4e..35343ceec604a13f581592ac2e50e2346947bc05 100644 --- a/docs/tutorial.rst +++ b/docs/tutorial.rst @@ -1,27 +1,37 @@ -======== -Tutorial -======== +========= +Workflows +========= -Project preparation -=================== +Structure calculation with EC restraints +======================================== The ``ariaec`` Command Line Interface (CLI) is the main tool for converting and analyze contact map information. The main command of this interface is ``ariaec setup`` which create an ARIA project XML file. Then we can follow the usual steps for an ARIA project. + Configuration file ------------------ -All the parameters for ``ariaec`` commands are encapsulated on a configuration file in INI format +All the parameters for ``ariaec`` commands are encapsulated on a configuration +file in INI format. Each time you need to overwrite the default parameters, +another configuration file can be used with the updated parameters. There is +no need to give all the parameters in order to have a correct configuration +file. + + + +A more detailed description of the parameters is in :doc:`configuration` +section. -Project template ----------------- +Restraints & project conversion +------------------------------- -Setup ------ +Build infrastructure +-------------------- Running ARIA diff --git a/docs/usage.rst b/docs/usage.rst index 6f1c402ee803bff2f9a886a43dd848220d98d9da..9151d3e92933b1248c3314bccf764ac228a4022d 100644 --- a/docs/usage.rst +++ b/docs/usage.rst @@ -17,7 +17,7 @@ ARIAEC .. code-block:: shell - ariaec COMMAND [OPTIONS] ARGS + ariaec COMMAND ARGS [OPTIONS] **Commands** @@ -71,7 +71,7 @@ Translate contact maps as distance restraints and initialize a new ARIA XML proj .. code-block:: shell - ariaec setup [OPTIONS] SEQFILE INFILE [INFILE ...] -o OUTPUT_DIRECTORY -t INTYPE [INTYPE ...] + ariaec setup SEQFILE INFILE [INFILE ...] -o OUTPUT_DIRECTORY [OPTIONS] -t INTYPE [INTYPE ...] **Arguments** @@ -135,6 +135,12 @@ Translate contact maps as distance restraints and initialize a new ARIA XML proj - :sup:`*` Accepted contact map formats combining formats supported by ConKit_ with few supplementary formats: ``gremlin``, ``pconsc1``, ``pconsc3``, ``pconsc2``, ``bbcontacts``, ``metapsicov_stg1``, ``membrain``, ``metapsicovhb``, ``comsat``, ``casprr``, ``ccmpred``, ``plm``, ``bclcontact``, ``epcmap``, ``evfold``, ``native``, ``pconsc``, ``psicov``, ``freecontact``, ``genericstructure``, ``ncont``, ``plmc``, ``plmdca``, ``metapsicov_stg2``, ``native_full``, ``metapsicov``, ``evcoupling``, ``contactlist``, ``plmev``, ``mmcif``, ``casp``, ``pdb``, ``flib`` +.. warning:: + + The contact map format option needs to have the same number of format that + the number of contact of pdb files. Since this is a greedy option, it needs + to be at the end of the command in order to work correctly. + Bbconv ++++++ Translate BBcontacts as distance restraints which can be used during @@ -142,7 +148,7 @@ Translate BBcontacts as distance restraints which can be used during .. code-block:: shell - ariaec bbconv [OPTIONS] CONTACTFILE SSPRED SEQ [MSA] -t CONTACTYPE + ariaec bbconv CONTACTFILE SSPRED SEQ [MSA] [OPTIONS] -t CONTACTYPE **Arguments** @@ -191,7 +197,7 @@ Contactmap analysis and visualisation tool. .. code-block:: shell - ariaec maplot [-h] [--filter] [--onlyreport] [--no-filter] [--ssidx] [--prefix] [--prefixname PREFIXNAME] seq sspred infile [infile ...] -t intype [intype ...] --merge mergetype [mergetype ...] + ariaec maplot SEQ SSPRED INFILE [INFILE ...] [OPTIONS] -t INTYPE [INTYPE ...] --merge MERGETYPE [MERGETYPE ...] **Arguments** diff --git a/src/aria/conbox/maplot.py b/src/aria/conbox/maplot.py index 4d624485912f479584f2b471681f307b63df5303..3b3d3fda35514bd3cb010901ef9545bffa8669ba 100644 --- a/src/aria/conbox/maplot.py +++ b/src/aria/conbox/maplot.py @@ -128,7 +128,7 @@ class AriaEcContactMap(object): mergecontactmap = mergemaps.get("maplot") for mapname, mapt in self.allresmap.keys(): if mapt != self.reftype: - # TODO: DON'T WORK !!!! + # TODO: DOESN'T WORK !!!! LOG.info("Merging %s with %s map", mergetype, mapt) up_map = self.allresmap[mapt]["maplot"] @@ -191,11 +191,14 @@ class AriaEcContactMap(object): cmpmap.write_contacts(mapname, scoremap=scoremap, outdir=outdir) - cmpmap.compare_contactmap(refmap, cmplist, prefix, + cmpmap.compare_contactmap(refmap, cmplist, + prefix if prefix else "cmp", distmap=self.refmap["distmap"], human_idx=True, outdir=outdir) - refmap.compareplot(cmpmap, outprefix=prefix, + LOG.info(prefix) + refmap.compareplot(cmpmap, + outprefix=prefix if prefix else "ref", outdir=outdir, save_fig=self.settings.maplot.config.get( "save_fig"), diff --git a/src/aria/conbox/protmap.py b/src/aria/conbox/protmap.py index 33c73404c921452d153d5c9434e0547ad4f6a2ee..5bae9d02197b657a8cc1c965f5384fa520e55bb3 100644 --- a/src/aria/conbox/protmap.py +++ b/src/aria/conbox/protmap.py @@ -490,7 +490,7 @@ class ProteinMap(Map): Parameters ---------- outdir : - param outprefix: (Default value = '') + param outprefix: (Default value = 'protein') size_fig : param plot_ext: (Default value = 10) plot_dpi : @@ -2470,16 +2470,6 @@ class MapFilter(object): """ # TODO: utiliser self.clash_dict au lieu de meta_clash - """ - - :param clash_dict: - :param desc_dict: - :param contactlist: - :param outdir: - :param outprefix: - :param clashlist: - :param human_idx: - """ meta_clash = { "cons": { "flag": 888, "msg": "", "warn": "", diff --git a/src/aria/core/xmlutils.py b/src/aria/core/xmlutils.py index f858498f5735d2aa858f873dfc77b9325aa75da8..3e0572cb463b54cb3eb081c092708064816dd432 100644 --- a/src/aria/core/xmlutils.py +++ b/src/aria/core/xmlutils.py @@ -101,6 +101,9 @@ class XMLElement: def get_cdata(self): return self.__cdata + def get_name(self): + return self.__name if self.__name else self.__class__.__name__ + # def get_name(self): # raise # attr = '_%s__name' % self.__class__.__name__ @@ -133,6 +136,12 @@ class XMLElement: return 'XMLElement(name=%s, tag_order=%s)' % \ (self.get_name(), str(self.get_tag_order())) + def __repr__(self): + print('XMLElement(name=%s, tag_order=%s)' % \ + (str(self.get_name()), str(self.get_tag_order()))) + return 'XMLElement(name=%s, tag_order=%s)' % \ + (str(self.get_name()), str(self.get_tag_order())) + class ContentConverter: """