Commit 1eafe0be authored by Blaise Li's avatar Blaise Li
Browse files

Fasta format issues.

parent 9cd31ca1
Pipeline #58017 passed with stages
in 16 seconds
......@@ -167,13 +167,13 @@ create a representation in fasta format of following sequence :
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT"""
>>> s = name + comment + '\n' + sequence
>>> s = ">" + name + " " + comment + '\n' + sequence
or
>>> s = "{name} {comment} \n{sequence}".format(id= id, comment = comment, sequence = sequence)
>>> s = ">{name} {comment}\n{sequence}".format(id=id, comment=comment, sequence=sequence)
or
>>> s = f""{name} {comment} \n{sequence}"
>>> s = f">{name} {comment}\n{sequence}"
Exercise
--------
......
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment