Unverified Commit 9cd31ca1 authored by Bertrand  NÉRON's avatar Bertrand NÉRON
Browse files

rename variable id in name

parent f732f95e
Pipeline #58008 passed with stages
in 12 seconds
......@@ -159,7 +159,7 @@ create a representation in fasta format of following sequence :
::
id = "sp|P60568|IL2_HUMAN"
name = "sp|P60568|IL2_HUMAN"
comment = "Interleukin-2 OS=Homo sapiens GN=IL2 PE=1 SV=1"
......@@ -167,9 +167,11 @@ create a representation in fasta format of following sequence :
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT"""
>>> s = id + comment + '\n' + sequence
>>> s = name + comment + '\n' + sequence
or
>>> s = "{id} {comment} \n{sequence}".format(id= id, comment = comment, sequence = sequence)
>>> s = "{name} {comment} \n{sequence}".format(id= id, comment = comment, sequence = sequence)
or
>>> s = f""{name} {comment} \n{sequence}"
Exercise
......
Markdown is supported
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment