Update README.md

README.md

@@ -99,7 +99,7 @@ VQGWSLCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293  -orf  -stop
 ```
-This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the ORF and its translation, respectively, with the two ending-up codons stop:
+This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the ORF and its translation, respectively, with the two ending-up stop codons:
 ```
 >CP003291.1 plasmid pAA-EA11::31436-31263
 TGAGTACAGGGCTGGAGCTTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTGCCATGGAACGTAGTACTCACCAATAAATAA
@@ -128,7 +128,7 @@ VQGWSLCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293  -fcds  -start PROK
 ```
-This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the CDS and its translation, respectively, by considering each of the three codons ATG, GTG and TTG as a putative codon start:
+This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the CDS and its translation, respectively, by considering each of the three codons ATG, GTG and TTG as a putative start codon:
 ```
 >CP003291.1 plasmid pAA-EA11::31418-31266
 TTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTGCCATGGAACGTAGTACTCACCAATAAA
@@ -138,11 +138,11 @@ TTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCT
 MCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK
 ```
 
-##### Coding Sequence (CDS) with alternate codon start and codon stop
+##### Coding Sequence (CDS) with alternate start codon and stop codon
 ```bash
 eFASTA  -f Ecoli.O104H4.plsm.fna  -c CP003291:31400-31293  -fcds  -start PROK  -stop
 ```
-This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the CDS and its translation, respectively, by considering each of the three codons ATG, GTG and TTG as a putative codon start, and including the termination codon:
+This command line allows writing the two files _seq.fna_ and _seq.faa_ containing the CDS and its translation, respectively, by considering each of the three codons ATG, GTG and TTG as a putative start codon, and including the termination codon:
 ```
 >CP003291.1 plasmid pAA-EA11::31418-31263
 TTGTGTGCACTGCTGTACGGGCTGATCGGCACCTGCCGTCTGAACGGTATCGATCCGGAAGCGTATCTGCGCCATATTCTGAGCGTACTGCCGGAATGGCCTTCCAACCGAGTTGGCGAACTCCTGCCATGGAACGTAGTACTCACCAATAAATAA