Skip to content
Snippets Groups Projects
Commit 7598e97f authored by Alexis  CRISCUOLO's avatar Alexis CRISCUOLO
Browse files

Update README.md

parent 9aec40c0
No related branches found
No related tags found
No related merge requests found
......@@ -123,6 +123,7 @@ as well as the file _seq.faa_ containing its translation (standard genetic code
>CP003291.1 plasmid pAA-EA11::31433-31266
VQGWSLCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK
```
Of note, it is the same results as with option `-orf` because the stop codon TGA is occuring first (before any start codon ATG).
##### Coding Sequence (CDS) with alternate codon start
```bash
......
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment