Skip to content
Snippets Groups Projects
Commit 7598e97f authored by Alexis  CRISCUOLO's avatar Alexis CRISCUOLO :black_circle:
Browse files

Update README.md

parent 9aec40c0
No related branches found
No related tags found
No related merge requests found
...@@ -123,6 +123,7 @@ as well as the file _seq.faa_ containing its translation (standard genetic code ...@@ -123,6 +123,7 @@ as well as the file _seq.faa_ containing its translation (standard genetic code
>CP003291.1 plasmid pAA-EA11::31433-31266 >CP003291.1 plasmid pAA-EA11::31433-31266
VQGWSLCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK VQGWSLCALLYGLIGTCRLNGIDPEAYLRHILSVLPEWPSNRVGELLPWNVVLTNK
``` ```
Of note, it is the same results as with option `-orf` because the stop codon TGA is occuring first (before any start codon ATG).
##### Coding Sequence (CDS) with alternate codon start ##### Coding Sequence (CDS) with alternate codon start
```bash ```bash
......
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment